ELF :4LøP4 (pŽŽŽDµDµÀÀÀðPÌÌÌ++²PW5C ˜9 ðOŒ`` … `×H.P ppp p%p p#p!þÿÿo(.ÿÿÿoðÿÿoæ+ 1̆Œª]wož#ºKJ"ú.5e¡åûHSIïd-ç;c2˜¥· é• ,÷ÒEê±¹OGÎi¯€4/ÆÔqz߬£Ÿ*Êž^œ9D‘Õ‡ø_Ŷ€QÞVÃǜ>Mˎ`~ýAW6›µr ™íRN‹”F+pBU[\²s0­La¿(x)Xk î:„ÏC3=n'ñÛ{!Г$àh %ÙfÁöü8jò…uìP×ôÿ»@Y&g®}È7<T§yšˆ?°ÝZƒӝ–|‰lbŸvŠ‚ tm©³ŠÑšÉäÜã—Ø¢«ðŽþÂæŒÖÍÇâÀùáèÚë óõ˜9 : pB ðO PP @µ ÀÀÀÀàÄðÛÜTàÄPWñÿ[PWñÿ2 ˜þ@  ,t ê ˜9…ðÛM : wp< fðÛñÿŒ < ðO _ðÛñÿ`×ñÿxPÝñÿ4 plp ƒˆ< rðÛñÿôÛ ÐOŒÀOW0“°OT¬ OŽ O€O¶ pOc {`O‚POÉ @OèŸüú )0OÇ OŒO°O,ÆðN¶àNš} ÐNlý ÀN1°Nr NNÒ €Nc pNM"ƒ `NñPNJ@NŒ0ND NŸN%NðMæàMÂÐM ÀMn °Mß  MÁMu€MípMw`M< PMÎ@Mx 0M”É Mž<MŒAM ðL àLa`1ü Ôü€ 3ÐL,ÀL_ 0ÏH°L" L•L¯€L®pLxä`LŠ9 D  ŸPL§@LLA0La l ŠÜ L¥L(ÃL4ðK­Œ0 ¹ àK„ÍÐKX®ÀKH°KX KùKÈ €KpK@ `KäøÛPK=@Kš Üå0K… K$P KKüðJTŠàJäµÐJòÀJK°J‰ JސJxŒ€J˜ pJ`Jå PJD›€úL 6@JD0Jö J J Jï Ðþ   ðI4TàI „ÐIüÀI°I„ï Iþ Ie€I?pI»`I|fPIh‚ @ITV 0I,[ IÛIT!I% ðHàH‹ÐH€ ÀHz°H@ç  H—Hq€Hí pH\`HàPHñ@Hx 0H5"ÿ HøHlHQ ðG# àGê ÐGÉÀGT°G0Ò G­GD €GÖ pG×`GPGTp @G(Î0Go G G4 Äd  GÉðF®(+D VàFG ÐF# ÀF™°F‘ F¹F‹€FÒpFp `F|} PFC äú Ù |/ä å@Fh‰ 0FX7 FdFµ F˜Á ðEð9àEŒÐETð ÀE^ °E9 E’ EÝ,û  €EüpE^`EÂPE« @EÍû 0 0E|·„ÿd œ E–‚ E-EñðD$ :ðþ@ œàD0 ÐDâŒüØ &"rÀD °D D˜D(¢ i €DÒ\20 GpD `DÇ ”ý< ZPDx|@D4 Ìú MDû¬ #0D˜ DªD.DZðC àC – ÐCTÀC°C@€  CӐCHî€CÿpCÿ `CPCÙ@Cpp0C÷ CàCA CÒ ðB³ l+ Á àBi ÐBÀBµµ°B8 BHB£0ÿT v €B èÿ  pB_GLOBAL_OFFSET_TABLE__gp_disp_fini__cxa_finalize__deregister_frame_info__register_frame_info_Jv_RegisterClassesdescriptionusecountkeyast_logoption_debugstrcmpast_copy_stringatoipthread_mutex_lockiax_frame_newiax_frame_wrapast_tvzerogettimeofdayast_tvdiff_msast_tvnowast_samp2tvast_tvsubast_tvaddpthread_mutexattr_initpthread_mutexattr_settypepthread_mutex_initmemsetaes_encryptmemcpyast_inet_ntoaiax_showframesendto__errno_locationstrerrorpthread_mutex_unlockmallocsetsockoptpthread_killreallocstrchriax_ie_append_strstrlenast_verbosepthread_mutex_trylockusleepoption_verboseast_getformatname_multiplerandiax_ie_append_addriax_ie_append_shortiax_ie_append_intast_waitfor_nast_readast_check_hangupast_frfreeast_writeast_sched_delast_queue_hangupast_update_use_countiax_ie_append_byteiax_frame_freeast_translator_free_pathast_variables_destroyjb_getalljb_destroyast_sched_addstrsepast_strip_quotedast_free_hastrncasecmpstrdupast_add_extensionast_exists_extensionast_context_remove_extensionast_dnsmgr_releaselocaltime_rast_localtimeast_queue_framestrcasecmpast_truestrstrast_get_ipsocketcloseast_netsock_findast_netsock_sockfdast_netsock_bindast_netsock_unrefast_dnsmgr_lookupinet_atonast_append_haast_parse_allow_disallowast_callerid_splitsscanfmanager_eventast_device_state_changedaes_encrypt_key128aes_decrypt_key128ast_key_getast_signMD5InitsprintfMD5UpdateMD5Finalaes_decryptast_matchmore_extensionast_parking_extast_canmatch_extensionast_ignore_patternast_park_callast_hangupjb_nextast_tvast_codec_get_samplesast_bridged_channeljb_resetjb_putjb_getast_update_realtimeast_db_deliax2_regfunkjb_newjb_setconfast_db_getast_load_realtimeast_codec_pref_indexast_getformatnameast_channel_allocast_best_codecast_setstateast_pbx_startpbx_builtin_setvar_helperiax_prov_complete_templateast_clijb_setoutputjb_getinfovsnprintfregcompregexecregfreeiax_get_framesiax_get_iframesiax_get_oframespthread_mutex_destroypthread_cancelpthread_joinast_netsock_releaseast_manager_unregisterast_unregister_applicationast_cli_unregister_multipleast_unregister_switchast_channel_unregisteriax_provision_unloadsched_context_destroysigemptysetsigaddsetpthread_sigmaskast_sched_waitast_io_wait_threadidast_sched_runqunload_moduleast_custom_function_unregisteriaxpeer_functionstrrchrstatopenunlinklseekmemcmpmunmapmmapast_config_AST_VAR_DIRopendirreaddirclosedirast_callerid_mergestrncatast_gethostbynameast_codec_pref_convertast_tvcmppipeast_channel_defer_dtmfast_waitfor_nandfdsast_channel_undefer_dtmfpbx_builtin_getvar_helperpbx_findapppbx_execast_translator_best_choiceiax_provision_buildiax_ie_append_rawiax_provision_versioniax_ie_appendastman_get_headerast_check_signatureast_apply_haast_variable_newast_cdr_amaflags2intstrncpyast_config_loadast_variable_browseast_variable_retrieveast_str2tosast_context_findast_context_createast_netsock_list_allocast_netsock_initast_category_browseast_config_destroyast_custom_function_registeriax_set_outputiax_set_errorio_context_createsched_context_createast_cli_register_multipleast_register_applicationast_manager_register2ast_channel_registerast_register_switchast_pthread_create_stackiax_provision_reloadast_shrink_phone_numberrecvfromiax_parse_iesast_set_read_formatast_moh_startast_moh_stopstrcpyast_codec_chooseast_codec_pref_stringpthread_attr_initpthread_attr_setdetachstatepthread_attr_destroyast_channel_masqueradeast_do_masqueradeast_async_gotoast_set_write_formatast_db_putast_app_messagecountbcopyast_swapcopy_samplesast_app_has_voicemailiax2_stateiax2_flagsiax_ie2strstderrfprintfstdoutfputsstrcatstrftimeiax_provflags2strtemplatesast_cli_registerast_getformatbynameast_db_deltreeast_cli_unregisterlibgcc_s.so.1libc.so.0_ftext_fdata_gp_edata__bss_start_fbss_endGCC_3.05P&y }àÄäÄ0Ï4Ï8Ï<Ï@ÏLÏPÏTόϐϔπϚϬÏäÏèÏìÏüÏÐÐ<Ð@ÐDÐTÐXÐ\ДИМРЬаЎÐìÐðÐôÐøÐÑÑDÑHÑLÑ\Ñ`ÑdќѠрюўьÑôÑøÑüÑ ÒÒÒLÒPÒTÒdÒhÒlÒ€ÒšÒ¬ÒŒÒÀÒÄÒüÒÓÓÓÓÓTÓXÓ\ÓlÓpÓ¬Ó°ÓŽÓÄÓÈÓÌÓÔÔ ÔÔ Ô$Ô\Ô`ÔdÔtÔxÔ|ÔŽÔžÔŒÔÌÔÐÔÔÔØÔ ÕÕÕ$Õ(Õ,Õ0ÕdÕhÕlÕ|Õ€Õ„ÕŒÕÀÕÄÕÔÕØÕÖÖÖ Ö0Ö4Ö8Ö<Ö@ÖDÖÀÀ$À(À,À0À4À8À<À@ÀDÀHÀLÀTÀXÀ\À`ÀhÀlÀtÀxÀ|À€À„ÀˆÀPÖTÖŒÀÀ”À˜ÀœÀ À€ÀšÀ¬À°ÀŽÀžÀŒÀÀÀÄÀÈÀÌÀÐÀÔÀØÀÜÀàÀäÀèÀìÀðÀôÀøÀüÀÁÁÁ ÁÁÁÁÁ Á$Á(Á,Á0Á4Á8Á<Á@ÁDÁHÁLÁPÁTÁXÁ\Á`ÁdÁhÁlÁtÁxÁ€Á„ÁŒÁÁ˜ÁœÁ€ÁšÁ°ÁŽÁŒÁÀÁÈÁÌÁÔÁØÁàÁäÁìÁðÁøÁüÁ Â(Â,Â4Â8Â@ÂDÂLÂPÂXÂ\ÂdÂhÂpÂtÂ|€ˆŒ” €¬°žŒÂÄÂÐÂÔÂÜÂàÂèÂìÂôÂøÂÃà ÃÃÃ$Ã(Ã0Ã4Ã<Ã@ÃHÃLÃTÃXÃ`ÃdÃlÃxÃ|ÄÈÐÔÜàÚìÎÞÃÀÃÄÃÌÃØÃÜÃäÃèÃðÃôÃüÃÄÄ ÄÄÄ Ä$Ä,Ä0Ä8Ä<ÄDÄHÄPÄ\Ä`ÄhÄlÄtĀĄČĐÄ×××@×D×HהĜĀĬĎČÄÄÄÌÄL×U<žœ'!à™àÿœ'Œ¯¿¯Œ¯<”œ'!àŸ$€™ô:9' ø Œ¹$ ø $ ‚KŠ ŒHšc0€%CKŠ`>¹$ ø Hš ŒÀ "¢èB–‚B–Š–ÿC0%C#¢"¢OŠLš B$ª º ªºªº(BŽ@ªdb(@ºd$'b(@'$ªºcŽ$b$cŽ$bÿÿ$ª ºb$bŽ B®bþÿ$bŽ$CB®ÌCŽb03@ b0%@€‚$ÜBŒ@$€™/Š,š @Ё™Š!  š!(ôÿB$$ØG& ¢¯Š!  š!(ôÿB$¢¯$0G& ø  Œ$€™!( @F&@D&šG9' ø  &  Œ(€‚(€… €‡ÐTB$à‚™¢¯0R¥$Țç$$ ø $ ŒUÀ€„?ª<ºCª@º$€™#ªžÜ„$A9' ø  º Œ€ƒ¬ÜbŒ@¬Üd$¬ ¬Üp¬‚Œ?Pš<Pž‚ŒCª@º¬€ƒ€„¬Üc$bŒ$€™B$žÜ„$ôM9' ø b¬ Œ$€‚€‚™ ø ðÄDŒ1 ŒÌBŽB0·@$$€™EŽ N9' ø 0D&!ˆ@%@ ŒD&TBŒcŽB$X%Ž!C+EY@€‚<ÿóB4+E:@$™p‚™P$Ž ø Œ¥$ Œ!@$™(€• &Ž(€'@ €”X"ŽP#®B$$ ø X"®$– Œÿƒ0"% ƒ(€ƒ€¯Uc$£¯¢¯X"Žà‚™¢¯0R¥&øš‡&! ø É$, Œ ø $$– Œÿƒ0¢¯(€‚"à‚™% ƒ$UB$0R¥&øš‡&Ë$¢¯€¯ &Ž(€' ø $$– Œÿƒ0¢¯(€‚"(€… €‡% ƒXUB$à‚™¢¯€¯0R¥$øšç$Ð$ ø $I Œ€‚P$Ž(ÜCŒT"Ž! ‚@<$b`Œ…$b–‡$ÿC0%CŒ‚ £ €B–ÿC0%C£ ¢ ŠšÿÿB0ÿC0%C£ ¢ T"ŽB$€B–À‡$ÿC0%CŒ‚ £ b–ÿC0%C£ ¢ T"ŽB$T"®ìƒ™eŽfŽ ø ! àdŽT"Žd#Ž!Dc$ ŒT"®d#®$€™ôM9' ø ! w ŒGŠDš/Cÿÿ$ÿÿ$'ª$º+ª(ºcŠ€4`š! úÿF$úÿ@ À –€B4ÿC0%Cà KŠŠHššB0 (ÿc0%(£ÿ¢0*%(¢ Å OŠLšB$ª º ªºª?º'ª$º+ª(º–cŠÿC0`š%Cüÿ†$üÿ‚ àŠšÿÿB0ÿC0%Cà OŠLšB$ª º ªºªºÌCŽb0@!  b0 @(€…$€™!(À@D&@F&šG9' ø  &  Œ(€‚ €‡ÐTB$à‚™¢¯0R¥$Țç$$ ø :$ Œ! $€™K9' ø  Œ !8°'!(` ø ! €B– ŒL±¯<¢§d¶¯Äþhµ¯¿Ÿ ·¶µŽü³ø²ô±ð°àœ'<@ûœ'!à™ ÿœ'X¿¯ Œ¯(¢¯t¢$€™0¢¯ €‚,НžšB$@¢¯p¢!0àD¢¯|¢x§¢¯€¢(¥'¢¯„¢4 ¯¢¯8 ¯xQ9' ø < ¯ ŒX¿à`œ'<°úœ'!à™Èÿœ'0¿¯(Œ¯H¢$€™¢¯L¢.¢¯$ ¢¯ ¯ ¯$ ¯\9' ø .(Œ0¿à8œ'„ £‚0@l‚™ ¹Œ ¢!1¯4P¬#̂™ˆ €‚0'@„ €>l‚™„ €! À ø !( ŒÌ‚™ ø ! <£@¢ Œ@£¯<¢¯sþD£¯ýÿ$ÀB4À¯À" £Œ €B4!~¬À"¯€¬ ¹Œ ¢!1¯@¬ £Œ ¹!d¬0¯ÿÿ$$€™! `ðg9' ø !(€ Œ€€ƒ(Ýc$!CBŒ@ð@€€!CBŒ@$€™ð@€! `P9' ø !(€ Œ!@| ¿x Ÿt ·p ¶l µh Žd ³` ²\ ±X °à€ œ' &(€…!  ø `Z¥$ @ Œ<‚™EŽ ø &p@ Œ‡¬€™(€…ˆ‚™lZ¥$ ø ! @ Œ4€™EŽØ–9' ø ! ` Œ(€…ˆ‚™|Z¥$ ø ! @ Œ(€…ˆ‚™„Z¥$ ø !  @ Œœƒ™EŽ˜Ž ø !  ŒJ˜®(€…ˆ‚™ŒZ¥$ ø !  @ Œ$‚™DŽ &s& ø ; Œ(€…ˆ‚™€Z¥$ ø ! @ ŒŽ€™EŽ-&(€…ˆ‚™”Z¥$ ø ! @ ŒŽ€™EŽ"à&(€…ˆ‚™ Z¥$ ø ! @ ŒŽ€™EŽ0&(€…ˆ‚™Äx¥$ ø ! @ ŒŽ™@B0 @DŽ ø ÿÿB0ÿC0 Œ%CŠ ø ÿÿB0ÿC0 Œ%CúöŠ(€…ˆ‚™¬Z¥$ ø ! @ ŒŽ€™EŽìP&(€…ˆ‚™žZ¥$ ø ! @ Œ8™FŽÐ&$& $(€…ˆ‚™ÀZ¥$ ø !  @ Œ8™FŽÐ&$&!8 ø Ò Œ(€…ˆ‚™ÌZ¥$ ø !  @ ŒDŽ„™P$¢¯Ì&P$ ø |&Ž Œ–þB4(€…ˆ‚™ØZ¥$ ø !  @ ŒŒ‚™ ø DŽ Œ@އþ€b4„þÿ$(€…ˆ‚™àZ¥$ ø ! @ ŒŽ€™EŽ ,&(€…ˆ‚™èZ¥$ ø ! @ ŒŽ€™EŽ•@&(€…ˆ‚™ðZ¥$ ø !  Œ,@ˆ‚™(€…QŽøZ¥$ ø ! #@ Œ(€…ˆ‚™üZ¥$ ø ! @ ŒÐ$„®(€…H‚™! pb¥$ ø „&$vC Œ(€‚°¯[B$¢¯(€… €‡BŽà‚™¢¯0R¥$8œç$$ ø ù $ Œe„®(€…!  ø h[¥$@ ŒŒ‚™ ø DŽ ŒY”®(€…ˆ‚™|[¥$ ø ! @ Œ(€…H‚™DŽpb¥$ ø ˆ&$IC Œ(€‚°¯Œ[B$¢¯(€… €‡BŽà‚™0R¥$8œç$$!$¢¯(€…ˆ‚™ü[¥$ ø ! '@ Œ(€…H‚™DŽpb¥$ ø Œ& Œ$à‚™(€…C €‡(€‚°¯\B$¢¯BŽ0R¥$¢¯8œç$$!$ ø  Œ(€‚0R¥$„\B$¢¯ŒŽ8œç$¢¯$ ø !$ Œ(€…ˆ‚™!  ø €\¥$@ ŒŽ€™EŽ(& ø P$ ŒRŽ£ý@(€…$Ž@$$®Žýÿ$$C®$€ôŠè€™ ø ! €  Œ˜Ž#ý ˜®$ýœެ€™ ø !  Œ!€!@¿<µ8Ž4³0²,±(°àHœ'<ܯœ'!à™Èÿœ'0¿¯,±¯(°¯ Œ¯!€€(€… €‡€Žÿÿ$à‚™0R¥$,ç$ö$$`|®(€‚£¯°\B$¢¯ ø °¯ Œ€Ž(€†(€…‚™ä\Æ$Ø\¥$!8$ ø ¢¯ Œ!((€„(‚™ ø ]„$ ŒxŽ@! @$€™Äx9' ø  Œ€‚4€†T‚™ŒސÜDŒ€®x®!8 ø äËÆ$ Œ|®0¿,±(°!à8œ'<Ä®œ'!à™Øÿœ' ¿¯±¯°¯Œ¯lƒ™!ˆÀ ø !€€Œ! P™!(  ¿±° (œ'ƒ©@! (€‚(€… €‡à‚™üjB$0R¥$4Ÿç$ñ$¢¯¶¯ ø  ܏D„™ ø DŒ ܏¢¯(€‚(€… €‡,kB$à‚™¢¯0R¥$4Ÿç$÷$ ø $È Üš™dÑ' ø ! FŠ ܏F𔁙$ÐÿÅ0*6%C%0Å%0F!  ø *E& ܏(Ð'Dƒ™!(  ø !  ܏! `‚™E& ø $@ ܏(€‚ €‡(€…à‚™@kB$¢¯¶¯4Ÿç$0R¥$ÿ$ ø $ ܏øÅ4„™ ø ! @“ ܏€‚&ÝPŒŽ ø $& @ ܏ Ž5@"’C’$’E’%D%eÿD0ÿe0"*%D%e*CC@4„™øÅ ø ! @ ܏°€™ ø ! `  ܏ŽÄ™ÙÿE&ȃ™ ø $@ ܏g! ‚™! @!($ ø !€@ ܏ÿÿ$€„®݃Œ®ݐ¬Ž€4„™ ø Ž ܏Ž€°€™ ø  ܏øÂ!®®®F ®Pƒ™!(೯ ¯$ ø $!@ÿÿ$nÿB ܏Wÿ4™áÿ! 4™ ø  ܏D„™ ø DŒ ܏¢¯(€…(€‚ €‡à‚™\jB$0R¥$4Ÿç$×$¢¯²¯±¯4™ ø  ܏D„™ ø DŒ ܏¢¯(€‚(€… €‡0jB$à‚™¢¯ޝ±¯0R¥$4Ÿç$Ð$ ø $ ܏°€™ ø !   ܏! `°€™ ø  ܏ÿÿ$!èÀx¿tŸp¶lµhŽd³`²\±X°!`à€œ'<Pœ'!à™Èýœ'4¿¯0²¯,±¯(°¯ Œ¯€„$€™A9' ø  ݄$ Œ$€‚ÝBŒ C¬BŒýÿ@(€†<„™(°'ðƒ‡! dkÆ$ ø $ ŒÔ™ ø ! !€@@ Œ+4™ C€.$b ø ±¯ Œ4€™Øþ9' ø ! @ @ ŒŽ‚(€„BŒˆ„™B(tk„$@!(  ø  Œxƒ™ ø !  Œ(²'(€† Q$<„™$gÆ$$(§'Üÿ@! @Ѐ™ ø !  Œ ø  ŒD„™ ø DŒ Œ¢¯(€ƒ(€…kc$ €‡£¯à‚™(£'£¯0R¥$$Ÿç$$ ø €$ Œ!€‚&ÝPŒ Ž@Ž ! @€‚Q®ÝQ¬Ž4„™`! `bˆb˜ÿF0ÿc02.%(£%F%(¢ ø *¥$ Œ°€™ ø Ž Œ¬€™ ø !  Œ!€ Úÿ€„$€™ôM9' ø  ݄$ Œ4¿0²,±(°à8œ'<Nœ'!à™˜üœ'`¿¯\³¯X²¯T±¯P°¯Œ¯¢(!€@!€À2$$¢!((€…Ä™Č ø Œk¥$ŒE,4€™$Ô9' ø  ŽŒ!ˆ@@ „™(€…! @ ø Äk¥$Œ! @(€… „™Èk¥$ ø !0  "‚@Œ(€‚àkF$(€‚ìkF$(€… „™ôk¥$ ø ! @Œ! @(€… „™ l¥$ ø &&Œ! @(€… „™$l¥$ ø €&&"Ž@B0@Œ(€‚B‚€‚ÅBŒï@(€‚;(€…Œ‚YŒ ø (܏€ €ƒ(€… €‡(Ýc$!ˆƒà‚™! @¬Æ'0R¥$ @üœç$0„‚%ŽYŒ ø ”¥$ @(܏©#Ž(€‚°¯ŽuB$¢¯$ ø D$(܏˜™(€…0Ä' ø ØW¥$!€@(܏! @Õÿ@$€‚ €‡ÜuB$à‚™¢¯0R¥$¬Â'üœç$$I$¢¯+²¯ €‡vB$à‚™¢¯0R¥$¬Â'üœç$$P$¥¢¯¬Ã!`ÿ$bŽ!( ø ¬Ä'o@(܏€‚ÅBŒš@$™ŠŽ4Ä' ø $(܏¢¯(€ƒ(€… €‡Tvc$à‚™£¯³¯0R¥$üœç$$Y$ ø …(܏¬ƒã@‰`€‚pÅBŒ€(Ýc$!CCŒ”b$h@€‚”b€e@€‚Ùø€™š™TÑ' ø ! (܏€€‚ø€™(ÝB$!bpŒ”& ø ! (܏!(”™!0@ ø ! (܏! @ø€™ ø !€(܏! ”™!(@ ø !0@(܏!( Dƒ™ ø DÄ'(܏!Ð(€…¬™@ DF¬Ñ'! $ ø ô]¥$&$ôÿ(܏ˆ‚™!  ø ¬Å' @(܏(€…˜™”^¥$ ø 0Ä'!@Áÿ@(܏Š€‚€‚€(ÝB$!bcŒ°bŒB40°b¬4Ä' ø $(܏¢¯(€ƒ¬Â'(€… €‡vc$¢¯à‚™¬Â'£¯ ¢¯³¯0R¥$üœç$$ ø t$(܏ÅBŒ @(€‚(€… €‡ÈvB$à‚™¢¯0R¥$üœç$${$ ø (܏bŽB0µþ@4€™d‹9' ø ! `°þ(܏€‚€(ÝB$!€bŽŽ€™Œ„$¬Å' ø P$À(܏ŽŽbŒ*Â@(€„Žv¬(€„(‚™]„$ ø !(`bŽB0X@(܏4€™d‹9' ø ! `(܏Q!À@#€,€‚$€™(ÝB$!€ôM9' ø ! (܏¬Ñ'4€™! $Ô9' ø $(܏!˜@$€™A9' ø ! wþ`(܏]þ€‚B0ÿ@€ƒ¹þ€Âþ@Ž€™¬Ð'0À¯! !(@ ø $(܏0Яáþ˜™ÅBŒ§ÿ@(€‚çþ(€…B0ÿ@¬ƒþþā™$bŽB0ÿ@€‚ÿ€ƒ ø ! C$(܏ÂÀ#è£샙!(F$ ø (€'(܏Rÿ0¯ÅBŒˆÿ@$™`ÿŠŽ!èÀпÌŸÈ¶ÄµÀŽŒ³ž²Ž±°°àØœ'< œ'!à™žÿœ'<Ÿ¯!ð @¿¯8²¯4±¯0°¯Œ¯!€!€  T‘Œ¢€@ø€™(€‚ðvP$ø€™ ø ! C$܏ÂÀ샙#è£!(F$ ø €'܏! @䀙|$ ø !€@@܏@  €‚lCŽ šB$ bÿÿ#2(€‚(€… €‡à‚™øvB$0R¥$DŸç$$Ë$¢¯ `€‚€(ÝB$!ˆb$Ž€(€‚4‚Œ@4€™(€‚(€… €‡wB$à‚™¢¯0R¥$DŸç$$Ï$ ø ÿÿ$܏…Œ!00„$!8À)9' ø  ¯܏!@ށ‚BŒB(@$™"Ž4FŒ Ä' ø $܏!(@(€„ˆ„™Dw„$!0 ø !8@܏!èÀ!@@¿<Ÿ8²4±0°àHœ'<( œ'!à™°ÿœ'HŸ¯!ð L¿¯D·¯@¶¯<µ¯8ޝ4³¯0²¯,±¯(°¯ Œ¯$€™! €€„!€ÀÔ܄$A9' ø !˜  ܏€‚ÐÜQŒ ø #@ ܏!€ L1ŽÄ™! ÷ÿ !(€€„$€™ôM9' ø Ô܄$ ܏ȃ™ ø T$@ ܏4!ˆL"ŽL®€‚ÐÜC¬€„$€™ôM9' ø Ô܄$  ܏ ‚™! @!(T$ ø !ˆ@ ܏!°!š! ‚™! !( ø T$ ܏\7&€‚€ƒPÜBŒ€2®|"®XÜb$DˆJˆXÜd˜Eˆ CˆFˆGˆHˆIˆC˜I˜J˜G˜H˜ E˜F˜€‚$$®|ÅDŒ€‚Ž€™4ÜBŒ,#®ô"®(*®0%®4&®!(€8'®<(®@)®x$®P$ ø !  ܏! à€…Ž€™üÅ¥$ ø $ ܏t$Žîÿ<ß?B4$ ‚€‚t$®(ÜCŒ< ÀB4$b% ƒ! ˜t$®pŽˆ‚™€Z¥$ ø ! @ ܏ȃ™T$ ø rŽ!€@‰@ ÜŽ€™!(@! @ ø P$ ܏€P®P®~! ! {H0®(€…ˆ‚™|Z¥$ ø ! @ ܏(€…ˆ‚™„Z¥$ ø !  @ ܏œƒ™eŽD&Ž ø !  ܏eD"®(€…ˆ‚™tw¥$ ø ! $@ ܏pŽø€™ ø ! C$ ܏ÂÀ#è£샙!(F$ ø  €'!€@M@ ܏䀙! @ ø =$G@ ܏ԃ™@ !  ø E$!@?@ ܏P"Žb¬;P#®(€…ˆ‚™žZ¥$ ø ! @ ܏8™fŽ$$&x%& $(€…ˆ‚™ÀZ¥$ ø !  @ ܏8™fŽ$$&x%&!8 ø  ܏(€…ˆ‚™ŽY¥$ ø ! @ ܏Œ‚™ ø dŽ ܏@t#Žb4÷ÿ$$bt"®t"ŽB0@(€‚(€… €‡|wB$à‚™¢¯±¯0R¥$ œç$$ ø m!$ ܏t"Ž.÷ÿ$(€…ˆ‚™üY¥$ ø ! @ ܏4€™@–9' ø dŽ ܏ëð"®(€…ˆ‚™Z¥$ ø ! @ ܏4€™Ø•9' ø dŽ ܏Ýô"®(€…ˆ‚™Z¥$ ø !  @ ܏Œ‚™ ø dŽ ܏@t#Žb4Ít"®ïÿ$üÿ$b(€…ˆ‚™Œw¥$ ø !  ܏ @ˆ‚™(€…pŽÌw¥$ ø ! @ ܏t"Žêÿ@B4(€…ˆ‚™Ôw¥$ ø ! @ ܏ t"Ž(€…ˆ‚™!  ø àw¥$š@ ܏t"Ž<%CÕÿ€B4(€…!  ø Z¥$ @ ܏Œ‚™ ø dŽ ܏@t#ŽÇÿ b4Èÿßÿ$(€…ˆ‚™,Z¥$ ø !  @ ܏Œ‚™ ø dŽ ܏@t#Ž<µÿ%bïÿ<µÿÿÿB4(€…ˆ‚™˜Y¥$ ø ! @ ÜŽ€™eŽb $&(€…ˆ‚™ˆY¥$ ø ! @ ܏P"‚@P2&Ž€™eŽT! @(€…ˆ‚™ÌZ¥$ ø !  @ ܏dŽ„™P$¢¯Ô%&P$ ø „'&t"Ž ܏†ÿB4(€…ˆ‚™èw¥$ ø ! @ ÜŽ€™eŽ ø$&(€…ˆ‚™ôw¥$ ø ! @ ÜŽ€™eŽ! à+$(€…ˆ‚™x¥$ ø ! @ ܏h„™ ø dŽA ܏(€‚(€… xB$¢¯bŽ €‡¢¯bŽà‚™¢¯0R¥$ œç$$ ø •!$  ܏p"®(€…ˆ‚™àZ¥$ ø !  @ ÜŽ€™eŽ $&P$ ø  ܏(€…ˆ‚™!  ø 0x¥$@ ܏™ ø dŽC(  ܏|"®sŽhþ`(€…ð"Ž@P"‚4@ #‚`$$ð"®t"Žýÿ$$CÀt"®è€™ ø ! À ܏* $€™Øe9' ø !  % ܏D6ŽH5ŽD ®H ®ìý€2ŽíýL#Žø€™ ø ! @ ܏O$(€…‚™#0”^¥$ ø ! B ܏ø€™ ø ! @ ܏eސ‚™#0 ø ! BÅÿ ܏$Ïÿ`ð"®Ìÿ$!èÀ! L¿HŸD·@¶<µ8Ž4³0²,±(°àPœ'At¢€‚(€†€ÜDŒ€‚Ðƒ™ŒÜEŒ€‚`|Æ$@ÜBŒ!8À¢¯(€‚ ¯„‚B$ ø ¢¯!€@@ Œ4™ ø  ŒD„™ ø DŒ Œ¢¯(€ƒ(€… €‡h|c$à‚™£¯0R¥$Ȟç$$ ø  #$ ŒŽ‚BŒB(@(€„ˆ„™|„$ ø !(À Œ „™ ø !  Œ! ƒ™ ø (Å"® Œt¢@€‘€ü™ ø „ÜŽ Œì™ ø  Œaû@„Ü®@™ ø ! @ Œ€‘€xÜ$Ž|ÜŽ*d@(€‚(€… €‡è|B$à‚™¢¯€¯£¯£¯0R¥$Ȟç$$ ø #$|ÜŽ ŒxÜ"®(£€‚„ƒ™! à!(˜|ÅC¬(€…ˆ‚™Xx¥$ ø ! `Ž@ Œ(€†Àƒ™€`Æ$! à ø !(`!@x@ Œ(€…ˆ‚™D}¥$ ø ! @@ Œ(€…ˆ‚™¬`¥$ ø ! @@ Œ<™! à ø !(` Œ! `4€™!(@(L9' ø !0!ˆ@@ Œ€$€™A9' ø ÔÜ& ŒÔÜ&€ƒ$€™ÐÜbŒôM9'L"® ø ÐÜq¬ Œ(€…ˆ‚™Ž`¥$ ø ! @@ Œ(€…ˆ‚™¬`¥$ ø ! @'@ Œ<™! à ø !(` Œ! `4€™!(@ôš9' ø !0!ˆ@>@ Œ€$€™A9' ø ðÜ& ŒðÜ&€ƒ$€™ìÜbŒôM9'œ"® ø ìÜq¬"Ž@B0,@ Œ4€™(Ì9' ø ! & Œ(€…ˆ‚™D}¥$ ø ! @@ Œ(€‚(€…L}B$¢¯ €‡p¢à‚™²¯³¯¢¯0R¥$Ȟç$$ ø <#$ Œ(€‚(€… €‡p}B$à‚™¢¯³¯0R¥$Ȟç$$ ø ?#$ Œ„ƒ™!(`! à ø !˜@eÿ@ ŒX‚™ ø ! à Œ(¢Œ‚™ ø ! ý@ Œ ý€„l¿hŸd·`¶\µXŽT³P²L±H°àpœ'<àêœ'!à™Ðÿœ',¿¯(²¯$±¯ °¯Œ¯p™„„ ø Œ$€„„™ ø  g„$Œ$€„Xƒ™ ø ?„$Œ!04€„4€…h‚™œì„$ ø ì¥$Œ!(€„ ‚™(݄$ ø <Œ,€‚(ÝP$$€‚@FQ$!È  ø ! Œ <,€‚&(ÝB$!Cõÿ$€‚ä‚™€ ø Œ™ ø ŒÜ®Œ! @ŒÜŽ€‚`ÜD¬ €€’(€‚(€… €‡à‚™ÀTB$0R¥$`žç$$3&$¢¯ì™ ø Œ@€ÜB®(€‚(€… €‡Œ}B$à‚™¢¯0R¥$`žç$$9&$ ø ÿÿ$ñŒ@™ ø ! @Œì™€ ø Œ @„Ü®(€‚(€… €‡à‚™Ä|B$0R¥$`žç$$@&$çÿ¢¯@™ ø ! @Œ!È €„ ø žÜ„$Œ!È €„ ø Ô܄$Œ!È €„ ø ð܄$Œ!È €„ ø  ݄$Œ$€„Ð‚™ ø Lτ$Œ€‚4€…tÀDŒ€‚ƒ™xÀFŒ€‚HJ¥$ ø |ÀGŒŒ!((€„4€†(€‡šƒ™Àg„$Ô8Æ$°}ç$ ø  ¯Œ!((€„4€†(€‡šƒ™pêÆ$À}ç$Ìg„$ ø  ¯Œ!((€„4€™üU9' ø Ô}„$Œ€„t„™ ø À„$@Œ(€‚(€…à}B$¢¯ €‚ €‡à‚™ šB$¢¯0R¥$`žç$$ ø T&$Œ4€™ô9' ø ÿÿ$zŒ€„ƒ™ ø ,ք$ @Œ(€‚(€… €‡à‚™~B$¢¯0R¥$`žç$$ ø Z&$Œ€„4€†ì‚™ ¯ðĄ$$öÆ$!( ø !8!ˆ@ @ŒŽ‚BŒB(@ˆ„™(€„ ø (~„$Œ(€‚(€… €‡à‚™H~B$¢¯0R¥$`žç$$ ø a&$Œü™ ø €ÜDŽŒü™ ø „ÜŽŒ€„$€™A9' ø Ƅ$Œ€‚šÜPŒ4€™hÛ9' ø Œ$Žùÿ! €„$€™ôM9' ø Ƅ$Œ€„$€™A9' ø ð܄$Œ€‚ ìÜPŒŽA4€™€‚(ÅBŒ®@É9' ø ŒœŽ! óÿ!(€„$€™ôM9' ø ð܄$Œ4€™À9' ø Œ ƒ™ ø Œ! ,¿(²$± °à0œ'%š Ž€™ŽL„$ ø P$ ܏%Š%š Ž€™Ž „$ ø P$ ܏7%Š4%š Ž€™Ž`„$ ø $ ܏#%Š %š Ž€™Žì„$ ø P$ ܏%Š%š ŽE¬$Š$š€€ƒ€(Ýc$!CBŒD¬$Š$š€€ƒ€(Ýc$!CBŒD¬/$Š,$š€€ƒ€(Ýc$!CBŒ„D¬<$–€€ƒ€(Ýc$!CBŒìD¬+$Š($š€€ƒ!˜€(Ýc$!CBŒ$ˆD¬;2Š3%Š82š0%š$  R€‚€€(ÝB$!€ŽP„™`„$ $ ø !8 ܏3%ŠŽP„™0%š@„$ $ ø !8 ܏ `B*€‚€(ÝB$!bcŒ„bŒˆb¬B*@€„$™ŠŽ(Ä' ø $ ܏¢¯(€ƒ(€… €‡à‚™ c$£¯²¯0R¥$œç$$ ø Ì$ ܏Uÿÿ$$€™A9' ø Ô܄$ ܏!€‚!€HÐÜQŒ€(ÝB$!bcŒìd$€8ƒ™ìb€Ó@ā™8ƒ™D$Ž ø !( 7@ ܏€‚€(ÝB$!bcŒ e$  b€È@$€™€ƒ€(Ýc$!CCŒìb$@ìb€Ä@€„P"‚@ "‚@D"Ž@*@! $*@!  $D"Ž@*@! $! $L1Žžÿ €‚€„$€™ôM9' ø Ô܄$L@ ܏€‚€(ÝB$!bcŒìs$K`ÿÿ$ìb€H@(€„“(€…!ˆ@(€…ˆ‚™$Ž ø €`¥$ ܏(€…ˆ‚™@¬`¥$0Ž ø !  ܏! (€…ˆ‚™@D}¥$ ø §@ ܏1Žèÿ (€…€4€™(ÜŽ! `B4Æ8Æ0(L9' ø !(@ ܏!ˆ@H™ ø ! @“  ܏(ÜŽ<$Dm@t#Žb4{t"® b€ @$€™€`?9'lˆ9' ø !  ܏!ˆ@P0ŽŽ ø Ž ܏! @€‚€(ÝB$€!bcŒŒbŒ‚¬Œd¬Žðÿԃ™|"Ž @€‚€(ÝB$!bdŒ€<Ì‚Œ%CÌ‚¬€‚€ (ÝB$! ‚$%Ž@#Ž(&Ž,'Ž0(Ž4)Ž8*Ž<+Ž‚Œ\C¬@E¬DF¬HG¬LH¬PI¬TJ¬XK¬…Œÿ¿$Ì£Œ<$bÌ£¬t"Ž@B0%bÿÿ<ÿB4$bÌ£¬t"Ž€B0%bþÿ<ÿÿB4$bÌ£¬t"Ž$D%bÌ£¬ô"Žì€$€¢¬ì¢€@€‚Ž€™!(  ø P$ ܏€‚€(ÝB$!beŒ÷ÿ$Ì£Œ €$$bÌ£¬t"ŽB0%bÌ£¬x"Ž€¢¬ ¢€ @€‚H%ޠހ™€…¬Å¥$ ø P$ ܏€‚€€(ÝB$!€ŽŽ€™ž„$ %& ø P$Žð"Ž\ƒ$ ܏`Œ‚¬\‚€ @¬‚$@C$¬‚€@C$*‚¬t"ŽB0@€‚€€(ÝB$!€ŽŽ€™@¬€¬„%&\D$ ø P$ ܏ŽŽ€™¬„$Ô%& ø P$Ž$ ܏b¬€‚€(ÝB$!bcŒüd$€Ž€™üb€@„%& ø P$ ܏ø"‚È@ø%&p$Ž€€ƒ€(Ýc$!CBŒ„D¬\"‚È@\%&€‚€(ÝB$!˜beŽïÿ<Ì€ŒÏÿB4$ ‚Ì€¬t#Ž<0B4$b% ƒÌ€¬ "‚À@ 2&Ž€™<€$P$ ø P%& ܏䀙!  ø /$ @ ܏E$  @ fŽÜ€™! <Æ$ ø P$@ ܏(€‚(€… €‡ìnB$à‚™¢¯²¯0R¥$œç$$ ø K$ ܏t"ŽB0@4€™lˆ9' ø !  ܏!£Ž¢Ž ¥Ž±Ž€„$€™8¯@ïð܄$Dů<ѯA9' ø :З ܏€‚ìÜCŒøbŒQöb” P€„$€™pŒð܄$ôM9' ø 2 ܏€‚œcŒîÿ`€„}$€™€‚€(ÝB$!bcŒÌbŒB4yÌb¬€‚€(ÝB$!bdŒ÷ÿ$Ì‚Œ$CoÌ‚¬ ø !( +þ@ ܏fþL1Ž`?9' ø H$Ž5þ@ ܏_þL1Ž$€™ôM9' ø Ô܄$®þ ܏ø‚™D„$Ød¥$!0` ø !8!@fþ@ ܏©ÿÿÿ$€$€™%dA9'ÔÜ& ø t"® ܏ÔÜ&€ƒ$€™ÐÜbŒôM9'L"® ø ÐÜq¬ ܏€‚€(ÝB$!bcŒ e$þ ™þP0Ž ø H$Ž„þ@ ܏|þ4€™†ÿÿÿ$€‚€(ÝB$!bdŒŽ€™p„$ ø $/ÿ ܏€‚€(ÝB$!bdŒŽ€™`„$ ø $/ÿ ܏ø€™ ø ! @C$ ܏ÂÀ#è£샙F$ €' ø !(@!€@9ÿ@ ܏Iÿ(€‚ôM9' ø ð܄$‰ÿ ܏!èÀ!@d¿`Ÿ\µXŽT³P²L±H°àhœ'<ÌԜ'!à™ØÜœ' #Ÿ¯!ð $#¿¯#·¯#¶¯#µ¯#ޝ #³¯#²¯#±¯#°¯0Œ¯ €‚ ‚™ü—C$Èã,#ůÉÄ'!($ ø <¯0܏@ïœ'°ƒ™<Â'0Ž'`×'öÖ',#!(À¢¯·¯$ ø !88¯A0܏4™ ø DŒ’$»‚0܏D„™ ø 0܏¢¯(€ƒ(€… €‡Pc$à‚™£¯0R¥$hœç$$ ø $©0܏€’DÜBŽ(@8Åš‚™ ø 0܏8€™ ø ! @0܏!(` €„<€™ÀŸ†ŒÄŸ‡Œ ø ! @0܏!(` €„<€™ÈŸ†ŒÌŸ‡Œ ø ! @0܏DÜDŽ8€™!€@ ø !ˆ`0܏! @€™!( !0@ ø !8`@0܏8ŏ¢,@÷“(€‚¥¯ €‡(€…\B$à‚™¢¯0R¥$$hœç$$($ø¢¯öÓ%C6@÷“ù“øÓ%CÿC0% C€‚0*@÷“¢,@$$™dƏpÄ' ø $bė0܏ÿƒ0"% ƒ(€…(€ƒ €‡à‚™„c$€¯0R¥$hœç$$-$£¯Í¢¯4€™¢¯,#ÿ„0!(!0à!8ÀÁ9' ø ¢¯0܏$‚ŠöÓ%CŠ@!šøÓ€B0†@€‚$'b¢,@úÒ'(€‚¥¯ €‡(€…ØB$à‚™¢¯0R¥$$hœç$$@$¢¢¯QŠ$€™øÿ¢$,#ŏQš`Ä'8¯ N9' ø ùד!€@@0܏$™dƏpÄ' ø $bė0܏ÿƒ0"% ƒ(€… €ƒ €‡à‚™ €c$€¯0R¥$hœç$$K$£¯}¢¯ÿ%2"ÿ„0*L‚™%d%Eø"Ä' ø %°bü"Ïø"0܏D®ÀH®™4Ž ø 8Ž@0܏DŽHŽ4®8®4Ž8Ž$€™! L¯ôM9' ø Pï0܏ P&â&’’’’’’"%E%f% ‡ÿE0ÿf0ÿ‡0*2:"%˜E%f%‡.úÿ%à&’’’’%D%eÿD0ÿe0"*%˜D%eüÿ%!$™dƏpÄ' ø $bė0܏ÿƒ0"% ƒ(€… €ƒ €‡à‚™L€c$€¯0R¥$hœç$$f$£¯ ¢¯8¯8*S}@,#ُ$¹¯4€™ÿd0!(`Æ'!8ÀÁ9' ø ¢¯ÿÿB00܏À@‚Š,€„$€™@À#b(݄$A9' ø ! d0܏ƒ–€‚€(ÝB$!ˆb#Ž$¢`T¯bŒ@(€…X¯`\Ó¯!  @p¯bŒÿÿ<$C$%R™˜eŒ ø ”dŒ@0܏$Ž‚™”„$ ø !(%ŽÛh<˜€Œ­‹B4‚Ã0܏C#C N$0Cp#†# ‚˜€¬"Ž$ƒ™˜GŒLďPŏ ø ”FŒ0܏!V‚ª‚ºƒ–€‚€(ÝB$!bbŒ°BŒB0d@ €‚dÀ¯|€B$l¯\ @hÀ¯TÏ$bˆ™ ø TÄ'0܏`¯`À¯Øƒ™€ªTÅ'! € ø €º0܏$€™0A9' ø ! € @0܏4€™! @$$Œ¶9' ø ‡&0܏‚–€ƒ€(Ýc$!CDŒƒŠ‚Œƒš+C3@tƒ‚ƒ¬BŒ/@ €‚(€…„€B$¢¯‚– €‡¢¯‚Šà‚™‚š0R¥$¢¯hœç$! ø Ÿ$0܏ €‚(€… €‡ €B$à‚™¢¯0R¥$hœç$$ ø €$0܏ €‚ €‡à‚™°€B$$¢¯0R¥$hœç$ ø §$0܏$€™d]9' ø „–0܏‚–,€„$€™@À#b(݄$ôM9' ø ! d0܏8!€³#S8¯8ȏ-Þþ@$§!èÀ€‚$ÜBŒ@öÑ'8Ï b, @ö“ôÿb$Ё™¢¯! !( $ ø `Ç'0܏ö“€B0M@öÓ'8 B,@$™dƏpÄ' ø $bė0܏ÿƒ0"% ƒ €ƒ(€… €‡è€c$à‚™€¯£¯¢¯0R¥$hœç$$»$ ø r0܏"’#’%CÿC0 $’%CÿR0Tį$ 0’ ‚$€ƒ€;y$ ø ¿2‚c00܏%C€;y$ ø ! 0܏TÏX¯$b!8XÏ$b $b$ b$$ b$ b$$!8!T¯XÀ¯$‚–@@!d’b’",#ُ% ‚ÿ‚0¹¯"4€™% ‚$ÿ„0!(@`Æ'ÀÁ9' ø ¢¯ÿÿB00܏@‚Š@!À# ‚,€‚$€™(ÝP$A9' ø ! „–€0܏€‚€(ÝB$!bcŒo`b’c’%CÿC0%(C€¢0_@XÏ $b$b$b$$bTÏ$Rb"’#’%CÿC0%CÿQ0ÿ°0€#6ÿ2ÿd0*%E$€™"%dV§$ $Tç^£XÀ¯\À£`>9' ø ]À£0܏_£€‚$ÜBŒ @$™Ð™ ¯! TÅ'!0 ø `Ç'0܏$™dƏÄ' ø $bė0܏ÿƒ0"% ƒ €ƒ(€… €‡à‚™8c$£¯¢¯€¯0R¥$tœç$! f$±¯ ø  °¯0܏$„‚™,#ď·¯¢¯TÅ' $ ø !80܏‚–¥@@šÀÌbŒB0'@4€™!( TÆ'(°9' ø 8Ç'@0܏ €‚(€… €‡\B$à‚™¢¯$0R¥$hœç$ ø ë$‚–0܏@!À# ‚! €‚$ÜBŒ @8Ё™ôÿB$¢¯! !( $ ø `Ç'0܏ƒ–€‚€(ÝB$!beŒŽ¢Œ0€$B$Ž¢¬ƒŒdCb—ƒ”C”$ b$ bb’c’%CÿC0%CÿB0‚¢€b’€B0v@€„tƒ‚BŒ@€‚$ÜBŒ@ €‚#’tB$¢¯T(€… €‡¢¯XÂà‚™£¯¢¯0R¥$hœç$! ø þ$0܏"Š#’"š'ƒª '’ÿF0$ƒº"%’ÿ„02+‡ª%d%F(‡º%b*ƒª€¥0 ƒº!˜TB8S,ƒ–€‚€(ÝB$!bdŒ'…Šº†$…šmÅXÏÀ$ b$b$b$b$bTÏ$]bXÏXď$‚ $ ‚$ ‚$ ‚$‚$‚$‚$‚tƒ‘TÏ$Wbtƒ‘"Ž@€ƒ €‚ €‡”B$¢¯¥¯T(€…à‚™Н €¯¢¯0R¥$hœç$! ø ($0܏€ƒ„–(Ýp$€!PCŒ'‚Šºc$‚š*C`$€™TÏ$bXÏ$ðb $íb"Ž @à‚™ €‚(€… €‡èB$¢¯0R¥$hœç$! ø /$0܏‡Š‚–‡š ¯ ¯+ƒŠ€!PDŒ(ƒš$$®£¯$ b $b$b$b$bÂ$TÏ$bÂ$º‚ 8ď ‚,@(€‚(€… €‡\B$à‚™¢¯€¯ $0R¥$hœç$$G$­¢¯…–€‚€(ÝB$!bfŒôÿ‚$\¯0Ä$ƒŒd—CTÏbׂ”bXÏ¥ $$™b¹ÑžÃ! +‚Š(‚š[D‚$ÿD0úÿƒ+ƒŠ(ƒšbƒ(€…S+‚ŠBŒ@€„€‚$ÜBŒ@$€™ €‚(€… €‡à‚™øB$¢¯±¯0R¥$hœç$! ø _$0܏€„$€™A9' ø žÜ„$0܏€‚,¬ÜPŒƒ––%b'Š$š!"ÿÿ$ªº3Š0š@€‚$ÜBŒ@$€™tƒ‚BŒ@ |9' €‚(€… ‚B$¢¯ €‡‚–à‚™¢¯0R¥$hœç$! ø h$0܏$€™ |9' ø „–0܏?Š<š!€@Ôÿ€„$€™ôM9' ø žÜ„$"&0܏ÿQ0+‚Š(‚š¬ÿ"tƒ‚„–€‚€(ÝB$!bcŒ÷`¹q  €‚ €‡à‚™\‚B$€¯¢¯£¯±¯0R¥$hœç$! ø x$0܏…–€‚€(ÝB$!bbŒ0D$ƒŒdCTσ”b— CTÏ$b@XéÿB$B,@\Ə@ÏÀ\ƏÀTÏ$bÅ'€™ ø 0Ä'@0܏$™dƏpÄ' ø $0܏$ €ƒ(€… €‡à‚™Œ‚c$0R¥$hœç$†$£¯@¢¯pÀ¯ pů$bÈÂ'pÀ¯p¯ ‚™0Ä'!( ø º$0܏TÏ$~b$€ƒ‚–(Ýp$€!PDŒXÏ‚Œªb €‚ƒ¬Ž‚B$(€… €‡¢¯XÂà‚™¢¯0R¥$hœç$! ø —$‚–€!PBŒ¬BŒ^@0܏€ƒ‚–(Ýq$€!QBŒ$€™¬DŒØg9' ø ̄$0܏"@’–,€$€™À@!# ‚(Ý&ôM9' ø ! 0܏„™ ø $0܏‚–$€™@!À# ‚A9' ø ! ‚–€!QCŒ)`0܏¬bŒ@!`Óÿ€ƒ€!QBŒ@¬DŒ'€€ƒ‚–(Ýq$€!QBŒ Œ¬CŒX$eŒ  ‚¬4ƒ™ ø ! `0܏‚–$€™€!QBŒôM9'¬DŒ ¬ ø ̄$ 0܏ €‚(€… €‡à‚™Ø‚B$0R¥$hœç$! «$±¢¯TÏ$!bTÏ€ƒ‚–(Ýq$€!QBŒXÏBŒ+b €‚(€… €‡þÿ$$p ƒB$à‚™¢¯£¯0R¥$hœç$! ø Ž$‚–0܏€!QCŒX$Pb¬TÏ$b€ƒ‚–€(Ýp$!PBŒEŒ  €‚‚™ ø ÜDŒ‚–0܏€!PCŒÿÿ$b¬tƒ‚BŒ@€‚$ÜBŒ@ €‚(€…DƒB$ €‡¢¯XÂà‚™¢¯0R¥$hœç$! ø À$0܏‚–€ƒ€(Ýc$!CEŒ„Š¢Œ„š+D"@XÏ$úb$<b $ btƒ‚€¬BŒ@Xŏ€‚$ÜBŒ@ÿÿ£$ €‚(€…„€B$¢¯‚– €‡¢¯‚Šà‚™‚š0R¥$¢¯hœç$! ø É$0܏Xŏÿÿ£$$b,[@€ €ƒü™c$!CBŒ!\@‚–€ƒ€(Ýp$!PGŒ°âŒB0‡@$¬çŒ à €… €†‚™€â$¢¯`ƒ¥$hƒÆ$ ø $0܏‚–€!PDŒÌ‚ŒB4Ì‚¬¥‹¢›i@Xŏ¬„Œf€ ƒ™ ø a@0܏‚– ƒ™€!PBŒ ø ¬DŒ0܏! @”‚™ ø !(S0܏‚–€ƒ€(Ýc$!CCŒ°bŒB0Q@$¬gŒàÌbŒB0 @€ƒ €… €†‚™€â$¢¯„ƒ¥$hƒÆ$ ø $0܏€ƒ‚–(Ýp$€!PDŒÿ÷$Ì‚Œ¬…Œ$C, Ì‚¬ ƒ™ ø !  '@0܏‚– ƒ™€!PBŒ ø ¬DŒ0܏ôƒ™ ø ! @0܏ƒ–€‚€(ÝB$!bbŒÐCŒ$b$€„$€™A9' ø žÜ„$0܏ÿÿ$€‚¬ÜDŒƒ–‚”b/‚ˆ,‚˜@…š…ž?‚ˆ<‚˜! @òÿ€$€™€„ôM9' ø žÜ„$0܏î Ñ' ‚™! !( ø $0܏‚–€€(Ý&!PBŒ„™€F”!  ø $‚–0܏ñˀîÛ$€™!PDŒÿÿ$£¯$$!8±¯È]9' ø ¢¯‚–0܏€!PCŒ$ÇÐb¬ƒ–€‚€(ÝB$!bbŒ°BŒB0Å@$Џ @µƋ²ƛ Àd@ÍNj4€™ÊǛ,#ŏŽ-9' ø `Ä'0܏„–€ƒ€(Ýq$!QBŒÌBŒB0@€‚4€™hƒ9' ø $0܏‚Š€‚HÜBŒ@4€™‡Š‚–‡š ¯ ¯+ƒŠ€$€™!Q(ƒšDŒ$$]9' ø £¯0܏4€™„–`Å'¬u9' ø 0Æ'0܏$@’–4€™! @L‚9' ø $0܏€‚ÅBŒv@$™dƏpÄ' ø $ƒ–0܏€!qdŒ €‡ …$ €ƒ¥¯(€…œ„$à‚™Œƒc$€¯0R¥$hœç$$$£¯í¢¯€!Q(€…DŒˆ‚™œ„$ ø to¥$@0܏"!˜,€$€™À@!# ‚(Ý&ôM9' ø ! ‚–0܏€!QEŒ`„™\¢$œŠ$! ¥$$ ø ¢¯!˜@0܏‚–$€™@!À# ‚A9' ø ! 0܏‚–€ƒ€(Ýr$!RQŒ<"&@ž"&<"‚d@ž"&@(€…ž"‚_@ā™to¥$ ø œ$&D@0܏B` ‚™êÐ'!($ ø ! 0܏!  €†ž™ÐƒÆ$ ø $0܏! ̃™*$ ø $‚–0܏í ˀ$€™!Rê ÛDŒÿÿ$$$!8°¯£¯ôt9' ø ¢¯0܏€‚ÅBŒï@$™dƏpÄ' ø $ƒ–0܏€!rdŒ €‡ …$ €ƒ¥¯(€…œ„$à‚™ìƒc$€¯0R¥$hœç$$&$£¯f¢¯Ì#Ž€b0@`ŏ<$b@(€‚(€‚àwU$ÔwU$ ‚™#Ž„"ŽèÄ' $!( ø $C0܏°Ä'(€”„™ ø Ôw&0܏Ôw&”„™ ø 0Ä'q0܏ P„™`$& $ ø !80܏€ƒ‚–(Ýq$€!QDŒœ™`„$ ø !(0܏%@’–€!QQŒÌ"Ž@B0 @ €‚(€‚|*Ž`#Žd$Žh%Žl&Žp'Žt(Žx)Ž ÌwU$\*Ž@#ŽD$ŽH%ŽL&ŽP'ŽT(ŽX)Ž0„U$èïìįðůôƯøÇ¯üȯɯʯ€!QBŒ\IŒ@CŒDDŒHEŒLFŒPGŒTHŒXBŒèï¯ €‚ìįðůôƯøÇ¯üȯɯ0„U$€‚–(Ý&€!PBŒTƒ™ˆCŒEŒèÄ'$(£ ø !0!@‚–0܏€!PDŒž€™°Å'`„$ ø $‚–0܏€!PDŒž€™0Å'@„$ ø $0܏–@€ƒ‚–€(Ýq$!QDŒ<Ì…Œ$²@ ‚™ˆ‚ŒƒŒ$Cd@€¢0 ‚™êÐ'!($ ø ! 0܏!  €†ž™8„Æ$ ø $0܏! ̃™*$ ø :$‚–0܏í ˀ$€™!Qê ÛDŒÿÿ$$$!8°¯£¯ôt9' ø ¢¯0܏€‚ÅBŒ @Xŏ‚–$™€!QBŒ(€“ÌBŒ €–$RpÄ'@dƏ ø $ƒ–0܏€!qdŒ €ƒ¢¯T„c$£¯„‚Œà‚™¢¯‚Œ0Re&hœÇ&$R$z¢¯ ø $ƒ–0܏€!qdŒ €ƒ¢¯°„c$£¯„‚Œà‚™¢¯ˆ‚Œ0Re&¢¯‚ŒhœÇ& ¢¯$ ø T$Ñ0܏@œ™ ‚™ $!( ø èÄ'‚–0܏€!QBŒ™CŒˆDŒ(€ ø $ ƒ0܏Ôw&”„™°Ä'!(  ø !@0܏0Ä'”„™ ø !( N0܏`„$ ø !(0܏<@’–€!QQŒÌ"Ž@B0@ €‚\*Ž@#ŽD$ŽH%ŽL&ŽP'ŽT(ŽX)Ž0„U$èïìįðůôƯøÇ¯üȯɯʯ`"Ž|)Žd#Žh$Žl%Žp&Žt'Žx(Žè¯(€‚ìïðįôůøÆ¯üǯȯɯÌwU$€‚ƒ–(ÝB$€!bbŒTƒ™CŒˆEŒèÄ'$(£ ø $0܏ !@€!QBŒ™CŒˆDŒ ø $ ƒ0܏!@ €‚0„U$¶@ ‚™êÐ'!($ ø ! 0܏!  €†ž™8„Æ$ ø $0܏! ̃™*$ ø :$0܏‚–€ƒ€(Ýq$!QCŒ €‚(€’…B$¢¯dŒˆbŒ €“$Dà‚™¢¯$0RE&w$ ø hœg&‚–0܏í ˀ$€™!Qê ÛDŒÿÿ$$$!8°¯£¯ôt9' ø ¢¯0܏€‚ÅBŒ@$™dƏpÄ' ø $ƒ–0܏€!qdŒ €ƒ¢¯°„c$£¯„‚Œà‚™¢¯ˆ‚Œ0RE&¢¯‚Œhœg& ¢¯$ ø z$0܏‚–€!QCŒÌbŒB4Ìb¬Žƒ°ŽcŒB4c((`°®$™dƏ$ ø pÄ'!ˆ@‚–0܏€!SBŒè™ ø „DŒ0܏! @聙 ø !€@0܏°Ã' €† €„Ô…Æ$ˆ„™¢¯0Â'£¯$¢¯,µ¯НН Н(Н8…„$!(  ø !80܏„– !0@°ŽcŒB4c(Ë`°®$™dƏpÄ' ø $0܏ €„ˆ„™e à…„$Œ"ŽB0@}ŋ$€™zś@<9' ø ! 0܏ ®€‚ƒ–(ÝB$€!bqŒ ‚™òÄ'!( ø $Ì"Ž€<$C=@0܏€„$€™A9' ø Ô܄$0܏€‚ ÐÜPŒ!  ø ì%&@0܏€Ž|Žbb$j€®LŽóÿā™f€„€„$€™ôM9' ø Ô܄$0܏òÐ' €†ž™†Æ$!  ø $0܏! ̃™*$ ø $õ‹0܏ò›$€™¢¯ÿÿ$! $$!8°¯ôt9' ø ¢¯B0܏„™òÒ'Œ&–! @ ø $Œ"ŽB0@0Üš‚™ ø ”0&0܏! (€†<„™pbÆ$!8@ ø  $0܏! @ž™!0 ø $0܏&ŽÀž™„™ÿÿÆ0! @ ø +$0܏ž™! @$ ø ì&&õ‹0܏ò›$€™¢¯ÿÿ$! $$!8²¯È]9' ø ¢¯!@"Ž@0܏Ì"ŽB4Ì"®)`Xŏƒ–€‚€(ÝB$!bcŒ°bŒB4°b¬“–€ƒ€(Ýc$!CQŒ°#Žb0@$b0@$0ҏ@€‚LÜBŒO@4€™Èƒ™ ø š$!€@>@0܏@„™Õ' ø !  0܏!  À€™ ø $0܏!  ‚™!( ø š$0܏&Ž€™ %&P$ ø ®0܏!(@Ž€™P$ ø T&0܏0‚™ ø \$&0܏!84€†ì‚™€®ŽÆ$ ¯@Ä' ø !(  @0܏ €‚(€… €‡à‚™8†B$¢¯0R¥$¬œç$$ ø Z$0܏l„™ ø !  È0܏(€‚(€… €‡à‚™XB$0R¥$¬œç$$^$ ¢¯$! `!0@\'& %&P²9' ø ¢¯³0܏‚–€ƒ€(Ýp$!PCŒ(€…ÌbŒ €‡B4Ìb¬ €‚à‚™X†B$¢¯‚–! ¢¯0R¥$hœç$ ø Œ$˜ē €0܏‚–€!PBŒ¬CŒû `ù Äd¬ ‚™TÄ'!( ø 0$$˜ēT¯$0܏ €X¯‚–€ƒ€(Ýc$!CBŒ¬BŒ@4€™ÄD¬4€™„–lŽ9' ø TÅ'0܏ƒ–€‚€(ÝB$!bdŒÌ‚ŒB0’@¬‚Œ@€‚ÅBŒ@ €‚4†Œ$™pÄ' ø $”Ï0܏`! @ €‚Œ†C$ €‚(€… €‡à‚™˜†B$€¯¢¯£¯0R¥$hœç$$ ø Ö$0܏ €‚(€…Ž†B$¢¯‚– €‡à‚™¢¯0R¥$hœç$! ø Ø$‡Š0܏‚–‡š€ ¯ ¯+ƒŠ(Ý&€(ƒš$€™!PDŒ$£¯]9' ø $„–0܏€!PCŒ$  šb¬‚–€ƒ€(Ýu$!UBŒ¬DŒ(€ €‚ ƒ™ ø "@0܏0Џ  €‚0™ ø 0܏! ā™ ø !(@0܏’–Í@ ƒ™€!UBŒ ø ¬DŒ!€@‚–0܏€!U䃙BŒ! ø ¬SŒ0܏! 䃙 ø !ˆ@!@U@0܏ $„™ €†<„™!8è†Æ$!  ø P$0܏(Ž$ŽŽ‚™(#®! !( ø $"®0܏P$&Ž€™P& ø P$0܏D$&Ž€™D& ø P$0܏”Ž €†<„™!8`ô†Æ$! @P$ ø ”"®0܏(cŽ$bŽŽ‚™(C®! @!(` ø $B®0܏PD&Ž€™Pe& ø P$0܏DD&Ž€™De& ø P$0܏”bŽx‚™”B® ø ! @@0܏ €‚(€… €‡à‚™‡B$$¢¯0R¥$Œœç$ ø ˜$0܏! @q$„™7 €‚$„™l! ȃ™ ø $!€@-@0܏@„™Ó' ø ! `0܏! `À€™ ø $0܏@Ä'4€†ì‚™®®µÆ$ ¯!(` ø !80܏@l„™ ø ! `‚–0܏€!UBŒ ƒ™ ø ¬DŒ @0܏mXŏ ø ! `0܏¬€™ ø ! 0܏€‚ƒ–(ÝB$€!bbŒ ƒ™ ø ¬DŒ0܏$ €ƒ(€… €‡à‚™‡c$0R¥$hœç$â$£¯²¢¯‚– ƒ™€!UBŒ ø ¬DŒ0܏! €ƒ(€… €‡à‚™8‡c$0R¥$hœç$ä$£¯ž¢¯€!UBŒ(€“ €– ø ¬DŒƒ–0܏€!ueŒ|„™0Ə! @ ¥$ ø $0܏’–@ ƒ™€!UBŒ ø ¬DŒ0܏¢¯ €ƒ0P‡c$£¯¢¯‚–à‚™€!UBŒ0Re& B$hœÇ&$ç$¢¯€!UBŒ ø ¬DŒ0܏¢¯ €ƒ0x‡c$£¯¢¯‚–à‚™€!UBŒ0Re& B$hœÇ&! ê$…¢¯ €‚(€… ‡B$¢¯ €‡‚–à‚™0R¥$hœç$! î$K¢¯‚–€ƒ€(Ýc$!CDŒ°‚ŒB0æ@$Ì‚ŒB0@‡Š‡š ¯ ¯G +‚Š\@ށ’¬‚Œ@ BŒ‚Œ„‚¬BŽB(@€ƒ€‚–(Ý&€!PBŒ$™4FŒ$ ø pÄ'!ˆ@‚–0܏€!PBŒè™ ø „DŒ0܏!(  €„ˆ„™È‡„$ ø !0@0܏€ƒ‚–(Ýq$€!QCŒ„dŒbŒ$‚D@ ‚™êÐ'!($ ø ! 0܏!  €†ž™8„Æ$ ø $0܏! ̃™*$ ø :$‚–0܏í ˀ$€™!Qê ÛDŒÿÿ$$$!8°¯£¯ôt9' ø ¢¯0܏€‚ÅBŒƒ@$™dƏpÄ' ø $ƒ–0܏€!qdŒ €ƒ¢¯ð‡c$£¯„‚Œ(€…¢¯‚Œ €‡à‚™¢¯0R¥$hœç$$ ø  $h0܏°bŒ¬eŒB4c °b¬BŽB( @ €¬è™ ø 0܏!(@ €„ˆ„™ ø <ˆ„$0܏€ƒ‚–(Ýq$€!QBŒ$€™¬DŒØg9' ø ̄$0܏"@’–,€$€™À@!# ‚(Ý&ôM9' ø ! 0܏„™ ø $0܏‚–$€™@!À# ‚A9' ø ! ‚–€!QCŒ+`0܏¬bŒ@!`Óÿ€ƒ€!QBŒ"@€„¬DŒ€(…Œ ð™ ø 0܏‚–€ƒ€(Ýp$!PBŒ¬DŒ$…Œ 4ƒ™ ø 0܏‚–$€™€!PBŒôM9'¬DŒ ø ̄$0܏€„$€™A9' ø ”Å„$0܏ƒ–€‚€(ÝB$!bbŒ ˆPŒ°Ž B0@4€™…–,9' ø ! 0܏ŒŽõÿ€„- ”Å„$ƒ–€‚‡Š(ÝB$€!b‡šdŒÿÿ$$$¢¯ ¯Æ ¯€ƒ‚–(Ýq$€!QBŒ@ƒ™œDŒ ø ÔÅ'0܏òÐ' ‚™!($ ø ! 0܏üÆŽƒ™!  ø .$à@0܏$௠b<ÓMÆ4FÃ0ìσ1#0Âÿ<ÿÿB4$bރ™6%0Ã!  ø /$0܏àÆŽƒ™!  ø 0$0܏Ə„™#0ÂÿÿÆ0!  ø 1$0܏ðÆŽƒ™!  ø 2$0܏ôÆŽƒ™!  ø 3$‚–‡Š€õË!Q0܏‡šDŒòÛ$l $€ƒ‚–(Ýq$€!QPŒ$€™! !(0B9' ø TÆ'ƒŠ„–ƒš€ #C0܏! ‘(®…ŒÔà됢¬Û“ȰŒ”¢¬ØÏÿ<ÿÿB4$b˜£¬Ü €¬œ¢¬å‹â›€¢¬é‹æ›K 𢬀Ž@Ž„Ž*Ã@(€Œ„Ž+DB@ €‚(€… €‡à‚™\ˆB$¢¯€¯0R¥$Z$hœç$°¯ ø $‚–0܏€!QBŒ(€… €†(BŒ‚™Ø\¥$„ˆÆ$¢¯'`(€Œ+Ä#@ €‚(€… €‡à‚™žˆB$¢¯€¯0R¥$`$hœç$°¯ ø $‚–0܏€!QBŒ(€…(BŒ €†‚™¢¯Ø\¥$àˆÆ$$ ø !80܏!((€„(‚™ ø ]„$0܏‚–€ƒ€(Ýc$!CDŒ”Ž(…Œ @€® Ž(‚Œ!CBÂ!CC(‚Œ|Ž ®€‚‚™ ø ÜDŒ0܏ƒ–‡Š€‚‡š(ÝB$ ¯ ¯€!b+‚Š$€™(‚šdŒ$$]9' ø ¢¯0܏$€™ |9' ø „–0܏x® €‚(€…‰B$¢¯€Ž €‡¢¯Žà‚™¢¯„Ž0R¥$¢¯hœç$! ø s$€Ž@0܏Ž„Ž*b@€‚€‚T‚™ÜDŒŒŽT‚™ÜDŒˆŽ4€†!8 ø äËÆ$0܏Ÿ |® €‚Øƒ™<‰B$l¯! €TÅ'dÀ¯hÀ¯ ø `À¯0܏XÏ $€„bD…& $K‚ªH‚º‚–†Š(݃$€!C$€™†šDŒÿÿ$xQ9' ¯ ¯{  ¯‚–(ݐ$€$€™!PDŒ!0 0B9' ø !(ƒ–0܏€„Š!peŒtƒƒ„šcŒ#Dh `€¢¬€‚$ÜBŒd @$™4ЌpÄ' ø $0܏¢¯ €‚(€…D‰B$¢¯‚– €‡€!PBŒà‚™€BŒ0R¥$hœç$! ‘$Ý¢¯‚–€ƒ€(Ýc$!CQŒ°"ŽB0@ ‚™¬"Ž@ €‚Œ†C$!@ €‚(€… €‡à‚™d‰B$0R¥$hœç$$š$¢¯“ £¯!(òÄ' ø $Pŏ0܏05&<0& î3&Ž€™ì$& ø P$0܏ŋ~ś Ž€™”$& ø  $0܏yNjvǛ à!â0 @!à}ŋ$€™zś@<9' ø ! 0܏ ®‚@4€™b‚ @@#&€„$€™A9' ø ð܄$0܏ÿÿ$€‚1ìÜPŒ@#&@(&òÂ'!0`!(!8@”$&¢¯µ¯£¯àš9' ø š¯0܏D!˜@Œ"‚f @Œ$&P‚j @P&øŽ€4€™ Ž£Ž$ ‚$CD@#&@(&òÂ'”$& &@&!8@¢¯£¯š¯àš9' ø µ¯!˜@@0܏œŽßÿS €„€„$€™ôM9' ø ð܄$0܏4€™@#&@(&òÂ'!8@”$& &@&¢¯µ¯£¯àš9' ø š¯!˜@ŽB0@0܏4€™d‹9' ø ! 0܏}‹z›@Ì"Ž0B4Ì"®`õË$€™òÛòÂ'¢¯ÿÿ$! $ $!8£¯È]9' ø ¢¯Ž @0܏PЏ€‚ €‚”‰P$€‚ƒ–(ÝB$€!bbŒ$™4FŒpÄ' ø $0܏°¯ €ƒ(€… €‡ ‰c$à‚™£¯¢¯0R¥$hœç$$ž$ ø m 0܏€‚HÜBŒ@€‚ƒ–‡Š‡š(ÝB$ ¯ ¯€!b+‚Š$€™(‚šdŒ$$]9' ø ¢¯0܏‚–€ƒ€(Ýp$!PDŒ°‚ŒB0@4€™¬‚Œ@ €‚Œ†D$! @ €‚(€… €‡à‚™d‰B$€¯0R¥$hœç$$©$ ¢¯h<9' ø 0Å'+@0܏€‚ÅBŒ@ ‚™‚–$™€!PBŒpÄ'4FŒ ø $0܏¢¯ €‚(€…Ì‰B$¢¯‚– €‡€!PBŒà‚™ìB$¢¯0R¥$hœç$$ ø ®$0܏ ‚™êÄ'!( ø $0܏„–Î$‚–(€…€!PPŒˆ‚™œ&to¥$ ø ! @0܏ !ˆ`„™\&!0 ¢¯ &! ø $0܏!ˆ@€ƒ‚–(Ýr$€!R(€…PŒÄ™to¥$ ø œ&:@0܏8 €‚ÅBŒ@$™dƏpÄ' ø $ƒ–0܏€!rdŒ €ƒ …$ €‡¥¯(€…à‚™œ„$ìƒc$€¯£¯¢¯0R¥$hœç$$ ø º$0܏ ‚™êÐ'! !( ø $0܏!  €†ž™ÐƒÆ$ ø $0܏! ̃™*$ ø $‚–0܏€í ˰!RÌŽ€b0@`ŏ<$b@(€‚(€‚àwU$ÔwU$Ž ‚™„ŽèÄ' $!( ø $C0܏°Ä'(€”„™ ø Ôw&0܏Ôw&”„™ ø 0Ä'q0܏ P„™`& $ ø !80܏€ƒ‚–(Ýq$€!QDŒœ™`„$ ø !(0܏%@’–€!QQŒÌ"Ž@B0 @ €‚(€‚|*Ž`#Žd$Žh%Žl&Žp'Žt(Žx)Ž ÌwU$\*Ž@#ŽD$ŽH%ŽL&ŽP'ŽT(ŽX)Ž0„U$èïìįðůôƯøÇ¯üȯɯʯ€!QBŒ\IŒ@CŒDDŒHEŒLFŒPGŒTHŒXBŒèï¯ €‚ìįðůôƯøÇ¯üȯɯ0„U$€‚–(Ý&€!PBŒTƒ™ˆCŒEŒèÄ'$(£ ø !0!@‚–0܏€!PDŒž€™°Å'`„$ ø $‚–0܏€!PDŒž€™0Å'@„$ ø $0܏N@ ‚™€ƒ‚–(Ýq$€!QCŒ<ÌbŒ$P!@€‚è™ ø „dŒ0܏¢¯ €‚(€…ô‰B$¢¯‚– €‡€!QBŒà‚™ˆBŒ0R¥$¢¯! hœç$ ø ß$‚–€!QDŒ…Œˆ‚Œ$¢=@0܏€‚ÅBŒ@ ‚™‚–$™€!QBŒ(€“ÌBŒ €–$PpÄ'@dƏ ø $ƒ–0܏€!qdŒ €ƒ¢¯T„c$£¯„‚Œà‚™¢¯‚Œ0Re&hœÇ&$å$Ï¢¯ ø $ƒ–0܏€!qdŒ €ƒ¢¯°„c$£¯„‚Œà‚™¢¯ˆ‚Œ0Re&¢¯‚ŒhœÇ&$ç$Ò ¢¯ÌƒŒ$p@€b0„‚Œ$¢w@ ‚™ßî Ð'$@œ™ ‚™èÄ'!( ø  $‚–€!QCŒÌbŒ$P@0܏„rŒdŒˆbŒ™ ø $ D0܏!@(€”„™°Ä' ø Ôw&0܏0Ä'”„™ ø Ôw&0܏NÔw&`„$ ø !(0܏<@’–€!QQŒÌ"Ž@B0@ €‚\*Ž@#ŽD$ŽH%ŽL&ŽP'ŽT(ŽX)Ž0„U$èïìįðůôƯøÇ¯üȯɯʯ`"Ž|)Žd#Žh$Žl%Žp&Žt'Žx(Žè¯(€‚ìïðįôůøÆ¯üǯȯɯÌwU$€‚ƒ–(ÝB$€!bbŒTƒ™CŒˆEŒèÄ'$(£ ø $0܏ !@€!QBŒ™CŒˆDŒ ø $ ƒ0܏!@ €‚0„U$j@ ‚™‚–€ƒ€(Ýp$!PCŒ €‚(€‘…B$¢¯dŒˆbŒ €’$Dà‚™¢¯$0R%& $ ø hœG&0܏€‚ÅBŒ>@ ‚™‚–$™€!PBŒpÄ'ÌCŒ<$b`dƏ ø $ƒ–0܏€!pdŒ €ƒ¢¯T„c$£¯„‚Œà‚™¢¯‚Œ0R%&¢¯hœG&$ $ ø 0܏ ø $ƒ–0܏€!pdŒ €ƒ¢¯°„c$£¯„‚Œà‚™¢¯ˆ‚Œ0R%&¢¯‚ŒhœG& ¢¯$$ ø 0܏ ‚™êÐ'! !( ø $0܏!  €†ž™8„Æ$ ø $0܏! ̃™*$þ:$î Ð'! !( ø $0܏! ރ™ $ ø !0@0܏‚–€ƒ€(Ýs$ñË$€™îÛ!SDŒÿÿ$£¯$$!8°¯È]9' ø ¢¯‚–0܏€!SPŒ(€…Ä™to¥$ ø œ&0܏°Ž6@ށ‘b4°®"ŽB('@$™dƏ$ ø pÄ'!ˆ@‚–0܏€!SBŒè™ ø „DŒ0܏! @聙 ø !€@0܏°Ã' €† €„Ô…Æ$ˆ„™¢¯0Â'£¯$¢¯,µ¯НН Н(Н<Š„$!(  ø !80܏„–!0@€!SCŒ°bŒB4«°b¬b4°®"ŽB(g@Xŏ$™dƏpÄ' ø $0܏ €„ˆ„™ÔŠ„$ ø !(@Y0܏€ƒ‚–(Ýq$€!QDŒ°ƒŒb0W@$ûÿ$$b°‚¬0ŏ Ž€™(€‚XrE$œ„$ ø P$‚–0܏€!QEŒ`„™\¢$œŠ$! ¢¯ ¥$ ø $@@0܏€‚ÅBŒ@$™dƏpÄ' ø $ƒ–0܏€!qdŒ €ƒ …$ €‡¥¯(€…à‚™œ„$‹c$€¯£¯¢¯0R¥$hœç$$ ø D$0܏ ‚™êÐ'! !( ø $0܏!  €†ž™ÐƒÆ$ ø $0܏! ̃™*$ ø $‚–0܏€í Ë!QDŒê Û$$!8°¯ð £¯‚–€!QDŒŽ‚CŒ°‚Œc(B4`°‚¬$™dƏpÄ' ø $ƒ–0܏€!qcŒ €„ˆ„™„fŒD‹„$ ø !(@0܏‚–$€™€!QCŒ$°bŒ! `B4°b¬ÿÿ$$!8¢¯ ¯È]9' ø  ¯„–0܏€!QBŒ„FŒ4€™`Þ9' ø $Œ@0܏6„–ƒ–€‚€(ÝB$!bcŒ†$šb¬ €‚(€t‹B$¢¯‚– €‘à‚™¢¯! 0R&V$ ø hœ'&0܏$€™ |9' ø „–0܏tƒ‚BŒ›@ €‚à‚™š‹B$¢¯‚–0R&hœ'&! Y$ô¢¯ €‚(€… €‡à‚™Œ‹B$¢¯0R¥$hœç$! ø \$0܏+‘Š€„$€™žÜ„$A9'(‘š ø ’–0܏€‚¬ÜPŒ–R€ƒ€(Ýc$!CBŒ @'Š$š*Q@$€™K9' ø ! 0܏?Š<š!€@êÿ€„ŽžÜ„$€‚HÜBŒ@4€™ƒ–‡Š€‚‡š(ÝB$ ¯ ¯€!b+‚Š$€™(‚šdŒ$$]9' ø ¢¯0܏4€™„–`Å'Ä@9' ø 0Æ'0܏ @’–! @$4€™L‚9' ø 80܏€ƒ€(Ýc$!CDŒ<‚$@ž‚$<‚€@ž‚$@XϞ‚€@$°‚ŒB0ú@XÏ$b€‚ ‚™`Ä'!( ø $0܏€‚––(ÝB$€!b ‚™bŒ±Ջ!($òÄ'ŒP$®՛ ø Žח0܏! 4€™$Ô9' ø $!@@0܏ €‚(€… €‡à‚™ì‹B$¢¯°¯0R¥$ ç$$ ø w$­0܏€‚<(ÜBŒ$C@ôS&CŽ<B4$b`d`Ñ' @4€“Ø™ ø @Ä'@Ə! !( (¿y&! !( (¿y&!0 ø ôS&0܏cŽdb‚‚c–b—Ÿb‚‚YŒ ! @ ø $0܏dÏhďlŏ`$™ôB®c®d® e®dƏÄ' ø $b×0܏ÿd0"%d£¯ €† CŽ<„™„Ð'£¯ŒÆ$!8@!  ø P$BŽB0q@0܏d<@ށ‘(€„Ì™Ø_„$!0 ø !(@"ŽB("@0܏€‚€(ÝB$!bbŒ°BŒB0@ €‚ €‚ ŒP$ŒP$$™dƏÄ' ø $bė0܏ÿƒ0"% ƒ€¯ €„ˆ„™,Œ„$!0!8@ ø !(@0܏(€… €†‚™Ø\¥$XŒÆ$!8@ ø $0܏! @4€™ä‰9' ø $-0܏"ŽB(@ €†€‚€(ÝB$!bbŒ°BŒB0@ €‚ €‚ ŒF$ŒF$ €„ˆ„™€Œ„$ ø !(@0܏ €†(€…‚™€ŒÆ$Ø\¥$!8@ ø $0܏! @4€™ä‰9' ø !(0܏!(@(€„T„™ ø Ø_„$0܏!(@(€„(‚™ ø ]„$0܏4€™! @@É9' ø !(À0܏,#EŽ B®€‚‚™ ø ÜDŒ0܏ÿÿã2`€€‚xÜC”|ÜŽ*ƒ@ €‚(€… €‡ÐŒB$à‚™¢¯€¯£¯²¯0R¥$ ç$$ ø §$0܏|ÜŽ€xÜŽ*d@ €‚(€… €‡ÐŒB$à‚™¢¯€¯£¯²¯0R¥$ ç$$ ø «$0܏xÜŽ B® C® CŽ`ž™d@òÐ'€À)#(¢€‚4€†!(£T‚™À(ÜDŒ'¥$<ÀÆ$ ø !8@0܏B®ž™òÐ'$!0@ ø ! 0܏4€™x9' ø (D&0܏! ރ™!0@ ø $dB@0܏„™ F–$ ø ! 0܏! ˜„™!0` ø $€B‚0܏#@€D&[BŽ€‚™ ø HÆ'DB(@0܏ÿ$D¯HB(@ÿ$H¯HDÏ%C ø !(ÿÿ4 0܏!`„™ÿÿF0òÄ' ø $0܏BŽB0 @ž™òÐ'$|F& ø ! 0܏! ž™$ ø ÌF&0܏' ¢‚$@€„)$€™0Ž!   ø &@0܏’’%C€„$€™ÿC0%€CôM9' ø  ݄$ 0܏„™1Žçÿ ā™K€„!0òÄ' ø "$0܏BŽB0@€‚4€™d‹9' ø ! @0܏€‚õȋ(ÝB$€!b$€™òțòÂ'dŒ¢¯ÿÿ$$$!8š¯ôt9' ø ¢¯ @0܏ €‚(€… €‡à‚™B$¢¯0R¥$hœç$$ ø n$0܏Џ;@XŏµƋ²ƛ7Àd6@$ÍNj4€™ÊǛ,#ŏŽ-9' ø `Ä'+0܏4€™Œ•$!  $Ô9' ø $!˜@C@0܏ ‚™òÖ'!($ ø ! À0܏$f–„™! À ø $$bŽB0@0܏€‚š‚™(ÝB$€ˆ!ˆ" ø 0Ž0܏”&(€†<„™! pbÆ$!8@ ø  $0܏&Žž™”Æ$! À ø $0܏ž™!0 ! À ø $bŽB0@0܏4€™d‹9' ø ! `0܏€‚€(ÝB$!bõ‹dŒò›$$!8©¶¯ €‚(€… €‡à‚™ì‹B$0R¥$dç$$è$¢¯7µ¯ €‚ ‚™ü—BëÄ'!(ÿ$ê£ ø ‘–0܏ò$ €ƒ ‚™ü˜b$DŒEŒü˜cŒ B”íëñÄ«õÅ«êûîÄ»òÅ»øÄ'!( ø ö§0܏ Ð' ‚™! !( ø $ċŠě€0܏d‚™!( ø $0܏Pŏ Ž€™êÄ' ø $0܏€‚€(ÝB$!bbŒŽ×ÄRŒ<$@ 8c €‚(€… €‡(B$à‚™¢¯0R¥$êÂ'|ç$$Ž$¡¢¯P&BŽŽŽ Ž€Â¯„ïˆÄ¯ŒÅ¯BŽdƏF QŽC–b—"b Â$™Ä' ø $0܏$ €ƒ(€… €‡à‚™Xc$0R¥$|ç$º$£¯¢¯€‚‚™ ø ÜDŒ0܏BŽ4€†€!bª*<«ªB4bÃT‚™#C€À)#(£!(¢€‚À(ÜDŒ ÞÆ$ ø !8@0܏B®Ž„Cށ‚–‚—üCށ‚BŒB(T@$ GŽÿÿ4*â@â( €†<„™ˆÆ$,Ä'@ €†<„™€Æ$,Ä' ø ($ 0܏$<„™â,Ä' €†ÀÆ$ €†ÜÆ$ ø ($0܏Ð'$™FŽ!  ø $D–0܏ÿƒ0(€†"% ƒ<„™êÑ'!8@€¯è_Æ$$ ø ! 0܏dƏ$™!  ø $0܏!(@ €„ˆ„™,Ç'!0  ø ø„$0܏dƏ$™!  ø $0܏!8@(€… €†‚™Ü_¥$0ŽÆ$ ø $0܏$RB® ø 0܏$ €‚(€… €‡à‚™`ŽB$¢¯0R¥$hœç$ ø w$B0܏‚–€ƒ€(Ýr$!RBŒÄQŒ9 €‚ÅBŒ-@”Џ$™ €‚”‰P$dƏpÄ' ø $0܏$& €ƒ(€… €‡xŽc$à‚™£¯€¯¢¯$°¯0R¥$hœç$ ø $‚–”ď€!RBŒ0܏€ÄCŒ €‚”‰D$(€… €†‚™€¯Ü_¥$šŽÆ$g$ ø $0܏ƒ–€‚€(ÝB$!bbŒÄCŒ$b¬ƒ–€‚‡Š(ÝB$€‡š!b ¯ ¯+‚ŠdŒ$€™(‚š$$]9' ø ¢¯0܏„–$€™ |9' ø 0܏ € ‚™ü—’ëÄ'!(ÿ$ê£ ø •–0܏ü—’ ‚™!(ê£ëÄ' ø ÿ$yҋPŏ0܏ vÒ›Ž€™êÄ' ø $0܏ŋ~ś Ž€™êÄ' ø $0܏ ‚™òÓ'! `!( ø $0܏€€‚(ÝB$!bbŒÄQŒ`  €‚"ŽdƏF$™#–b—b`0&Ä' ø $0܏$ €ƒ(€… €‡à‚™äŽc$0R¥$€ç$$£¯Q¢¯ €‚(€… €‡$B$à‚™¢¯Н0R¥$€ç$$ ø $0܏$D"®êÐ'a%&$ ø ! 0܏ø€™ ø ! 0܏!Â!0!8@êÄ'!(é@ !(!8@êÄ'!04€™`Â'³¯¢¯ ¯àš9' ø  ¯%@0܏$"®€‚õȋ(ÝB$€!b$€™òțòÂ'dŒ¢¯ÿÿ$$ $!8š¯È]9' ø ¢¯@0܏ïXŏ(€… €‡LB$à‚™¢¯0R¥$€ç$$$ ø 0܏ ‚™êÐ'! !( ø $0܏! (€†ž™žVÆ$ ø $0܏! ̃™*$2$ ø 0܏ƒ–€‚€(ÝB$!bí ‹dŒê ›$$!8°¯¹¢¯ƒ–€‚€(ÝB$!bށ‚cŒBŒB( @Ð`¬¬eŒ  €‚Œ†E$ €„ˆ„™ ø l„$0܏€ƒ‚–(Ýp$€!PDŒ ‚™Ø„$!( ø $‚–€!PBŒðB”™@0܏€!PDŒÐ‚Œ“@ÿÿ$$$!8Ѐ¬¢¯ ¯† ¯ƒ–€‚€(ÝB$!bdŒ$ЃŒ‰b$ށ‚$BŒB( @Ѓ¬¬…Œ  €‚Œ†E$ €„ˆ„™ ø ”„$0܏‚–€ƒ€(Ýc$!CDŒð‚”j@Xŏ€!CFŒ$ÐÌdb$ށ‚BŒB(@€¬…Œ  €‚Œ†E$¬ÆŒÀ €‚Œ†F$ €„ˆ„™ ø Œ„$0܏€„–(Ý&€!PEŒ$ð¢”êÑ'€!PCŒî Ò'ÌbŒÐf¬B4Ìb¬Ì¢ŒÐЬB4Ì¢¬$€‚ØpU$!È  ø ÿÿ$‚–!È €!PBŒ ø ðD”0܏!  ‚™!( ø $0܏! @ ‚™!( ø $‚–0܏€!PBŒ„™ðB”! €!PBŒ$ ø ‚F”‚–0܏€!PBŒ„™‚F”! @ ø $‚–0܏€í Ë!PDŒ$€‚ê ÛÈ]U$$$!8£¯!È ±¯ ø ³¯‚–ñˀ!PBŒîÛðB”$€!PDŒ$!8!È ²¯£¯å³¯€ƒ‚– ‚™(Ýc$€òÑ'!C! !($ ø PŒċŠě€0܏d‚™ Å' ø $0܏’×` €‚€ÆÀ(€…¢Â— @ €‚(€… €‡à‚™ØB$0R¥$žç$$$#¢¯èŠšÅ¬Ä ÂØ&$‚™Ø® d¬f¬e¬êÄ' ø Ü&$0܏ØŠ$Ю©‹Š›Ô®©ƋŠƛÀõÂ‹Žƒ™!  ø $0܏õ‹! ò›$$!8±¯¢¯‚–€ƒ€(Ýc$!CDŒÐ‚Œ×@$$!8 ¯ ¯$€™ \9' ø †0܏‡Š‚–‡š€ ¯ ¯+ƒŠ(Ý&€!P$€™(ƒšDŒ$$]9' ø £¯’–’ї€!P0܏ PŒ Ø& €‚(€… €‡ØB$à‚™¢¯0R¥$ȝç$$ ø h$N0܏ØŽ†Œ‡Œ ƒŒ0& ‚™0®F¬ C¬G¬!( ø $0܏ÿÿ$‚ŠèŠž¢¹¢º¢»¢Ð® ®®®®”®˜®Œ®®$€™hx9' ø °Ä0܏Hƒ™œŽ ø °Å'öÿ@0Üàƒ™ ø œŽ0܏è$€„$€™žÜ„$(®€®®®A9' ø  ®0܏ÿÿ$€‚ ¬ÜCŒb”Bdšdž?bˆ<b˜!@÷ÿ`$€™€„ôM9' ø žÜ„$0܏„–$€™Øp9' ø  0܏ €‚ƒ–ü—D€‚ ‚™(ÝB$€!bêÄ£!(ëÄ'ÿ$ ø vŒ0ŏ 0ÜŽ€™êÄ' ø $0܏ė‚0@‚0$@ƒ0$$@$ CÂ$€™€„Ž—”Å„$X$€$A9' šB ø  ˜0܏ˆЎ)!ˆÄ™P& ø êÅ'!@0܏ ŒŽŒ"®ˆ® ްŽ!Uƒ0š®Œ®`ŽŠ÷ÿ$$‚%R%S°®!ˆ!žDŒ€(€… ƒ™Xp¥$ ø $0܏1&$õÿ"!!ˆŒŽ×ÿ€„”Å„$$€™ÿôM9' €‚™Ó(€… €‡ôB$à‚™¢¯£¯0R¥$hœç$$Î$ ø š0܏ ‚™êÄ'!( ø $±ыœҋ®ћ0܏y ºқ"‚w@ÿÿ$ZÿS2€„$€™A9' ø  ݄$0܏€‚4ÝPŒŽÄ™¥$ ø ! ,@0ÜŽƒ™êÕ'!0@!  #$ ø ˆSpŽˆ˜ÿE0"ÿ„0*%E%d%b+#@0܏#€q+ €b„™*Æ$!0Ñ!  $$ ø !8V0܏ €„\‚™!   ø $$N0܏ŽÌÿ€„0$€™$€™ôM9' ø  ݄$0܏ƒ–€‚8À¯(ÝB$€!bí ‹dŒê ›$%$!8µ¯/¢¯„–€‘€(Ý1&!QCŒ €‚¥¯$B$€¯¢¯‚b” €‡(€…à‚™hœç$¢¯0R¥$! ø Ü$0܏êÐ' ‚™!($ ø ! 0܏XƓ̃™!  ø $‚–í ˀ!Q0܏DŒê Û$!$!8°¯£¯ÿÿ$¢¯$€™È]9' ø 0܏Xŏ$D¢$A¢$>¢ $;¢$8¢ƒ–€‚€(ÝB$!bdŒ0€»ƒº‚,b$‡Š‡š ¯ ¯+‚Š$(‚š¢¯$€™]9' ø 0܏ƒ–€‚€(ÝB$!bdŒ»ƒº‚b$€™‡Š‡š ¯ ¯+‚Š$(‚š$]9' ø ¢¯€0܏? ’–(݃$€!CCŒ$T¯bŒ @(€…ÒÂ%C8XïúÿB$@\¯pÀ¯ €‚ €‡HB$à‚™¢¯0R¥$hœç$õ$ ø $0܏„–$€™d]9' ø à0܏üÂ'p¯„–€‚ÒŒ(ÝB$€ ! ‚„Œ%eÿb0„Œ%b€$$ ‚ÿc0% ƒ„ª$@„º(݃$€!CCŒ$T¯bŒ@(€…X¯8üÿB$A\¯  €‚ €‚ €‡à‚™|B$0R¥$hœç$ $Åÿ¢¯ €‡ €B$à‚™¢¯0R¥$hœç$$$ ø ¢0܏@úÂ'p¯pÀ¯„–€‚c’(ÝB$€ e’! ‚‚Œ%eÿd0EŒ"ÿÿ<$(¢%d%(£…ª…º$„–€‚€(ÝB$!bbŒ°BŒB0I@ €‚dÀ¯|€B$l¯\@hÀ¯TÏ$bˆ™ ø TÄ'XÏ!0@`¯@$b0܏pď(„™ ø !(€0܏`À¯Øƒ™! € ø TÅ'0܏ƒ–€‚€(ÝB$!bbŒƒŠDŒƒš+ƒ@tƒ‚€ª€ºBŒ@ÿÿ$€‚$ÜBŒ@ÿÿ$ €‚(€…°B$¢¯T €‡¢¯XÂà‚™ €¯¢¯£¯0R¥$hœç$! ø :$0܏ÿÿ$‚ª‚º$€™0A9' ø ! € @0܏4€™! @!(`!0Œ¶9' ø ‡&0܏‚–€ƒ€(Ýc$!CDŒƒŠ‚Œƒš+C@tƒ‚ƒ¬BŒ@€‚$ÜBŒ@(€… €‚„€B$¢¯‚– €‡¢¯‚Šà‚™‚š0R¥$¢¯hœç$! Q$ ø 0܏‚–@ÊÀlæ XÏzæb’^çbYçTÏ ‚™î Ð'! !( ø $0܏! ރ™ $ ø !0@0܏‚–€ƒ€(Ýs$ñË$€™îÛ!SDŒÿÿ$$$!8°¯£¯È]9' ø ¢¯‚–0܏€!S(€…PŒÄ™to¥$ ø œ&‚ì@0܏±ìށƒÄ™ ø !(—ò@0܏²òœŽÄ™ ø ì%&“ò@0܏«òœŽ$€™ôM9' ø ð܄$0܏Œ$&4€™€Î9' ø !(!€@©ò@0܏Àò}‹B0€ø@DÅ'¶øƒ™A9' ø  ݄$0܏€‚êøÝQŒ¬Å€ÃšÄB®®® ®‹EŽš›G®äù¡ B®èùBŽ BŽúQ$¬úB®`"‚ û@&&ž™$ ø ! `0܏&–„™! ` ø $`#‚[$ ûb0܏ ûŽ€™Šý`ÿÿ$8¯! @ ø Äî0܏€„$€™ôM9' ø Ô܄$¹ì0܏$€™ôM9' ø  ݄$¶ø0܏ôM9' ø  ݄$0܏ÿÿ$8¯ƒ–€‚€(ÝB$í ȋ!bdŒê ț$$êÂ'!8¢¯š¯ÿÿ$¢¯$€™ÿýôt9'€„$€™ôM9' ø  ݄$0܏$8¯ƒ–€‚€(ÝB$í ȋ!bdŒê ț$åÿ%$@À,€„#b(݄$! d$€™ôM9' ø 0܏!èÀ$#¿ #Ÿ#·#¶#µ#Ž #³#²#±#°$à(#œ'<Ð\œ'!à™€‚!0pÁC$2$e$bŒÆ$D c$ࢌùÿÇ ¥$ €‚àПB$<„\œ'!à™€‚àTÖD¬Šÿÿ<–ÿc4J %ˆ$ÿ¥0%FB €†$ˆ#$€<„™%@ %8å%8òš¯Ž Æ$! `$°¯±¯ ø ¢¯T֙Ž ø ! ` £’$mb(Œâ*j@ ³&`â*r’G&*ç’ÿ@v’€‚!špÁQ$"Ž<V€‚9Ž`°'! f&!8@$ `Ž' ø (Œ'Ž €†<„™! €°¯à¡Æ$ ø $(Œ ! €<„™ €†!@ ! ”„™8¡Æ$$@!8@!È ø (Œ €…!  ø D¡¥$(Œ`°' €†<„™`¢''Ž! ¢¯à¡Æ$ ø $(Œ! €‚TÖYŒ ø µ&(Œ€‚ 1&ÈÃB$¿ÿ" #ò €†<„™`°'L¡Æ$!8À!  ø $(Œ€‚TÖYŒ ø ! (Œ#ò!rS$þÿw$â* ÿ@€‚ €„TÖYŒ ‰„$ ø (Œ€ ¿| ·x ¶t µp Žl ³h ²d ±` °àˆ œ'<”Pœ'!à™°ÿœ'H¿¯D±¯@°¯Œ¯$™!@À €†$!H x¡Æ$<„™!€€"â!ˆ ‰‰ ‰‰™ ™™™!0  €¯,£¯$¥¯0€'!È (¢¯ ø $"€—Œÿƒ0 €†"% ƒ<„™€¯!( ! l¡Æ$ ø !8@Œ ø ŒH¿D±@°àPœ'<šOœ'!à™Øÿœ' ¿¯±¯°¯Œ¯ÿÿ¥$*§!ˆà ˆ¢‚™!€€!€!(À ø !0 Œ¢ ¿±°à(œ'%C%8è %8G €…!0 Ì¢¥$<„Gœ'!à™Èþœ'0¿¯,³¯(²¯$±¯ °¯Œ¯ €‚ ‚™p­B! !˜€!(!€' ¢£!ˆÀÿ$ ø !€àŒ$øƒ™ €'!8 $Ž€™!0@"Š!Èà"šÿF0ÿc02†%€%F%€ ø !0Œ¢¯ €†<„™! `!(@Ø¢Æ$ ø !8Œ €…! ` ø Ì¢¥$Œ0¿,³(²$± °à8œ'(#º$‚ €†<„™ °'ޝP£Æ$! $$ ø Œ! €‚*PÖYŒBŠBšÿE0"ÿ„0*%d%E%b/#ª,#ºB&7"ª4"º$‚ €†<„™ °'„£Æ$ ޝB’C’%CÿC0%C;"ª8"º$‚ €†<„™ °'ž£Æ$÷ޝB’C’%CÿC0%Cö<"Š$‚ €†<„™ °'ì£Æ$åޝB’C’%CÿC0%Cäž"ŠB&A"ªà>"ºB&E"ªÜB"º$‚ €†<„™ °'$€Æ$ËޝB’C’%CÿC0%CI"ªÉF"º$‚ €†<„™ °'\€Æ$žޝB’C’%CÿC0%CM"ª¶J"ºB&Q"ª²N"ºB&U"ª®R"ºB&Y"ªªV"ºB&]"ªŠZ"º$‚ €†<„™ °'”€Æ$•ޝB’C’%CÿC0%C”^"Š$‚ €†<„™ °'È€Æ$ƒޝB’C’%CÿC0%C‚`"Š$‚ €†<„™ °'ü€Æ$qޝB’C’%CÿC0%Cpb"ŠB&g"ªld"º$‚ €†<„™ °'¶0¥Æ$B’bh"¢$‚ €†B’\i"¢<„™ °'©d¥Æ$$‚ €†<„™ °'œ¥Æ$GޝB’C’%CÿC0%Cm"ªEj"º$q"ªAn"º$u"ª=r"º$‚ €†<„™ °'Ð¥Æ$ÿþޝBŠBšÿE0"ÿ„0*%d%E%by#ª'v#º$‚ €†<„™ °'ŠÆ$éþޝBŠBšÿE0"ÿ„0*%d%E%b}#ªz#º$ ‚ €†<„™ °'ޝ<ŠÆ$! $Óþ$B’C’%CÿC0%C‰"ªû†"ºB&"ª÷~"ºB&…"ªó‚"º$‚ €†<„™ °'tŠÆ$µþޝBŠBšÿE0"ÿ„0*%d%E%b#ªÝŠ#ºB&‘"ªŽ"ºØ’4¢B&—"ª”"ºÓ˜4¢$‚ €†<„™ °'šŠÆ$•þޝ$£"ª "ºBŠBšÿE0"ÿ„0*%d%E%b#ªºš#º$‚ €†B’"ª³"º<„™ °'èŠÆ$! $ ø !8€zþŒ$‚ €†B’"ª£"º<„™ °'ðÿ§Æ$$‚ €†<„™ °'P§Æ$ŽÿޝB’C’%CÿC0%C"ªŒ"º$‚ €†<„™ °'ˆ§Æ$NþޝBŠBšÿE0"ÿ„0*%d%E%b§#ªv€#º$‚ €†<„™ °'Œ§Æ$8þޝBŠBšÿE0"ÿ„0*%d%E%b«#ª`š#º$5‚ €†BŠBšÿE0"ÿ„0*%d%E%b¯#ªO¬#º$‚ €†<„™ °'Œ§Æ$>ÿޝB’C’%CÿC0%C=°"Š$‚ €†BŠBšÿE0"ÿ„0*%d%E%bµ#ª,²#º$‚ €†<„™ °'ð§Æ$îýޝBŠBšÿE0"ÿ„0*%d%E%b¹#ª¶#ºD‚™ ø ! `Œ °' €†<„™! ³¯ޝ$šÆ$!8@ ø $Œ! €‚TÖYŒ ø Œ!T#Ž@¢þÿU$r$¢*uý@þÿ¢& @¢!€‚ €„PÖYŒ䢄$€‚ €„PÖYŒdš„$ ø Œÿÿ$8¿4µ0Ž,³(²$± °à@œ'<à:œ'!à™Øÿœ'$¿¯ ²¯±¯°¯Œ¯ø‚!€PŒ !ˆ  ø @Œ !Ž @!!€€Žˆ‚™&ñÿ! @!$¿ ²±°à(œ'èb®Lƒ™l±E&!  ø $@(Œä€™!  ø +$ @(Œ(€™$ŽT9' ø èpŽ(Œ%€䀙!  ø -$ @(Œ(€™$ŽT9' ø èpŽ'(Œ$€èp® €…ˆ‚™d¯¥$ ø ! @(Œ €‚°¯t±B$¢¯ޝ"Ž €… €‡à‚™¢¯P¯¥$àŽç$$k$ ø (Œ1ŽPþ (€’àÙ$ÚbŠXÀÙ$VàbŠ@¢@ށ‚€(€™”9' ø `Ö&(Œ`Ö&øƒ(€™bŒ¬9'€b® ø s¬(ŒŽ‚BŒB(@Ö& €„ˆ„™¬±„$ ø !(€(Œ„ƒ™!(€ ø !  (Œ! @aý€(€…X‚™ ø !   (Œ €‚ €… €‡Ø±B$à‚™¢¯P¯¥$°Žç$$ ø $(Œ!ˆ€„(€™”9' ø `ք$(Œø‚DŒ‚Œ@€Œ !ˆ€ ø‚€0®P¬¬€™ ø (Œ! ðÿ€€„ëýT`¢ªÿ`®(€™¬9' ø `ք$(Œ!( €„,™ ø  ²„$(Œl¿hŸd·`¶\µXŽT³P²L±H°!àpœ'<(,œ'!à™àÿœ'¿¯Œ¯D€‚€„Œ™@Ý@¬ ø ׄ$Œ¿!à œ'<ä+œ'!à™8ÿœ'Ä¿¯À¶¯Œµ¯žŽ¯Ž³¯°²¯¬±¯š°¯Œ¯ ‚™!šÀ!° $!(! à ø !€Œ€“(€™”9' ø `Öd&Œ!  (€‚pQ$!È  ø $!€@ @Œ(€„$!È  ø ŒR„$!€@Ž@Œ€ž™š‚Ÿ@$8Œ‚š&! @ ø $Œ! @ž™Œ& ø $Œ! @ž™Ð& ø  $ŒÚ–„™! @ ø $ŒÜŽŽƒ™! @ ø $Œà–„™! @ ø $ŒäŽŽƒ™! @ ø $ŒèŽŽƒ™! @ ø  $ŒìŽŽƒ™! @ ø  $9ŒŒ‚@ž™! @$ ø Œ&ŒÐ‚€@ž™Ú–À„™! @ ø $ŒÜŽÀރ™! @ ø $Œà–À„™! @ ø $ŒäŽÀރ™! @ ø $ŒèŽÀރ™! @ ø  $ŒìŽÀރ™! @ ø  $ŒðŽ@š™Ìƒ™ð’! @ ø  $Œš™P°' ø ! ŒFŠ”™Fš!  ø !(@Œ€'Dƒ™ ø !(¢€ £& ‚$¢Œ&CÀ&ˆ‚Ñ®Žƒ™! @$ ø !0 Œ(°' €†<„™!8 8²Æ$!  ø ($Œ!(  €„Ì™ ²„$ ø !0Œ€„(€™¬9' ø `ք$Œ! €„ €†Ì™ ²„$!(  ø @²Æ$Œ(€™¬9' ø `Öd&Œ ÿÿ$! @ ø š&wÿŒ! @ $ ø Ð&|ÿŒÄ¿À¶ŒµžŽŽ³°²¬±š°àÈœ'<Ô'œ'!à™hûœ'”¿¯ޝŒ³¯ˆ²¯„±¯€°¯ Œ¯ €‚ ‚™`ŽB!€!˜ )€'!((¢£! À ø O$ Œx°' ‚™!($ ø !  Œ(±'€„(€™”9' ø `ք$ ŒP$ €„Ü€™ ²„$!(` ø !0  Œ!  €…H‚™D²¥$ ø !0@ Œ$ €…Ä™! C@²¥$ ø  Œ! p„™!(@!8€!0`'@ÿÿ$ ø  Œ!€@ €… €‡à‚™P¯¥$ôŽç$! @ù$ €‚³¯H²B$ ø ¢¯ Œtƒ‚ €… €‡BŒà‚™P¯¥$ôŽç$! ý$ @!€ €‚CŽx²B$¢¯±¯ ø £¯ Œ€„(€™¬9' ø `ք$! Œ”¿ŽŒ³ˆ²„±€°à˜œ'<ð%œ'!à™Ðÿœ',¿¯(ޝ$³¯ ²¯±¯°¯Œ¯€„(€™`ք$”9'!˜  ø ! àŒ!ˆø‚PŒ ø Œ! `Lƒ™!(@ ø !0@@Œ1&*‘@0‚™€Žø€™&îÿ! `€„ ø ! @Œ!€@€„(€™¬9' ø `ք$!Œ,¿(Ž$³ ²±°à0œ'<ô$œ'!à™Ðÿœ'(¿¯$³¯ ²¯±¯°¯Œ¯!€€! 7€!˜À €‚3!€€ ˜ÄQ$"Žø€™$b@!  ø Œüÿ%Ž@‚™#BÿÿF$ ø ! Œø€™ ø ! Œ#B €…@‚™ ²¥$ÿÿF$ ø ! Œ€‚1&ØÄB$áÿ"‚@(€…ø€™ ø ! Œ!ÿÿ@ ‚™4m¥$ÿÿF& ø ! Œ!(¿$³ ²±°à0œ'<Ä#œ'!à™xÿœ'„¿¯€¶¯|µ¯xޝt³¯p²¯l±¯h°¯Œ¯ýÿ¢$B,!š !€@!°À±$€„(€™”9' ø `ք$Œ! ø‚ŽQŒ¢ˆ‚™ Ď ø %&†@Œ€ €… €… „™ ‰¥$ ø ! @Œ €… „™&&€²¥$ ø ! @T"‚Œ@T&& €‚°²F$ €… „™ž²¥$ ø ! @š"‚Œ@š&&(€‚\lF$ €… „™Ì²¥$ ø ! @Œ"‚Œ@Œ&&(€‚\lF$ €… „™à²¥$ ø ! @Ð"‚Œ@Ð&&(€‚\lF$ €… „™ô²¥$ ø ! @ŒÚ&– €… „™! @ ø ³¥$Œ°'(€‚Ü&ŽS$P$!È` ø ! Œ!0@ €… „™! @ ø ³¥$Œà&– €… „™! @ ø 0³¥$ä&Ž! !È` ø P$Œ!0@ €… „™! @ ø D³¥$Œè&Žøƒ™!  ø P$Œ!0@ €… „™X³¥$ ø ! @Œì$Žè™ ø ”&Œ!0@ €… „™! @ ø l³¥$Œð&Ž €… „™! @ ø €³¥$Œ€1Žrÿ $€„(€™¬9' ø `ք$€Œ$¢ „™ €…! @ ø ”³¥$Œ €… Ǝ! @ ø ž³¥$Œ!„¿€¶|µxŽt³p²l±h°àˆœ'<€ œ'!à™xÿœ'„¿¯€Ž¯|³¯x²¯t±¯p°¯Œ¯H€™(±'€¯¥¯ Н$§¯€' ø !( Œ@°'H€™ €' ø !((€Œ‚,@@£b,@$‚$b b$‚L€„¯‚,¢D£! &C+Š,¢¯b!ˆD£,¢! &C+D¢¯8€T£!@€dP¢<¥!0@!€`!À !ÈPXÅ!`B+ Š!hc! È+‹@H@!h€‹!+Š@!˜!$!! +0ˆ!(,!(Å+©!p€@!x  ©8+ˆ@B&+ R!“!@!˜`80¢HªB$!PB,£D¢!0 &b+ÿ<ÿÿT4X\£¯!80!h@`ª¯€<`!Xl! Â+P†!c!(ã!(E!@D+!He !HI1À!@@B % dB(!p€%xå!H`­%À BP%PJ+‰BX ðÿ@Àÿ@$⃌+Ç¢Œà#CÂ$ â2Â!+@àÿÿ$ƒŒÂ¢Œb‡ŒЌ*Ç@*æ@…Œ„Œ+å@å+§+Ä@+§ `àÿÿ$@ §!+†@!`à$ÿÿ$à $#8F!  À!€#XPÄàHå!( c(Å% I!€! à $#8F!  À!€#XPÅàHä! (b Ä%(I!€! à<@œ'!à™àÿœ'¿¯°¯Œ¯€‚ÀB$üÿP$ ø ŒŽÿÿ$úÿ"üÿ&¿°à œ'€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø  $€™!xà ø  $€™!xà ø  $€™!xà ø  $€™!xà ø  $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø $€™!xà ø ÿ$€™!xà ø þ$€™!xà ø û$€™!xà ø ú$€™!xà ø ø$€™!xà ø ÷$€™!xà ø õ$€™!xà ø ó$€™!xà ø ò$€™!xà ø ñ$€™!xà ø ð$€™!xà ø í$€™!xà ø ì$€™!xà ø ê$€™!xà ø é$€™!xà ø è$€™!xà ø æ$€™!xà ø ä$€™!xà ø â$€™!xà ø á$€™!xà ø à$€™!xà ø ß$€™!xà ø Þ$€™!xà ø Ü$€™!xà ø Û$€™!xà ø Ú$€™!xà ø Ù$€™!xà ø Ø$€™!xà ø ×$€™!xà ø Ö$€™!xà ø Ô$€™!xà ø Ó$€™!xà ø Ò$€™!xà ø Ñ$€™!xà ø Ð$€™!xà ø Í$€™!xà ø Ì$€™!xà ø Ë$€™!xà ø Ê$€™!xà ø É$€™!xà ø È$€™!xà ø Ç$€™!xà ø Æ$€™!xà ø Å$€™!xà ø Ä$€™!xà ø Â$€™!xà ø Á$€™!xà ø ¿$€™!xà ø Ÿ$€™!xà ø œ$€™!xà ø Œ$€™!xà ø »$€™!xà ø º$€™!xà ø ¹$€™!xà ø ž$€™!xà ø ·$€™!xà ø ¶$€™!xà ø µ$€™!xà ø Ž$€™!xà ø ³$€™!xà ø ²$€™!xà ø ±$€™!xà ø °$€™!xà ø ¯$€™!xà ø ®$€™!xà ø ¬$€™!xà ø «$€™!xà ø ª$€™!xà ø ©$€™!xà ø š$€™!xà ø §$€™!xà ø Š$€™!xà ø ¥$€™!xà ø €$€™!xà ø £$€™!xà ø ¢$€™!xà ø ¡$€™!xà ø  $€™!xà ø Ÿ$€™!xà ø ž$€™!xà ø $€™!xà ø œ$€™!xà ø ›$€™!xà ø š$€™!xà ø ™$€™!xà ø ˜$€™!xà ø —$€™!xà ø –$€™!xà ø •$€™!xà ø ”$€™!xà ø “$€™!xà ø ’$€™!xà ø ‘$€™!xà ø $€™!xà ø Ž$€™!xà ø $€™!xà ø Œ$€™!xà ø ‹$€™!xà ø Š$€™!xà ø ˆ$€™!xà ø ‡$€™!xà ø †$€™!xà ø …$€™!xà ø „$€™!xà ø ƒ$€™!xà ø ‚$€™!xà ø $€™!xà ø €$€™!xà ø $€™!xà ø ~$€™!xà ø }$€™!xà ø |$€™!xà ø {$€™!xà ø z$€™!xà ø x$€™!xà ø w$€™!xà ø u$€™!xà ø t$€™!xà ø s$€™!xà ø r$€™!xà ø q$€™!xà ø p$€™!xà ø o$€™!xà ø n$€™!xà ø m$€™!xà ø k$€™!xà ø j$€™!xà ø i$€™!xà ø h$€™!xà ø d$€™!xà ø c$€™!xà ø b$€™!xà ø _$€™!xà ø ^$€™!xà ø ]$€™!xà ø \$€™!xà ø [$€™!xà ø Z$€™!xà ø X$€™!xà ø W$€™!xà ø T$€™!xà ø S$€™!xà ø R$€™!xà ø Q$€™!xà ø P$€™!xà ø O$€™!xà ø N$€™!xà ø M$€™!xà ø L$€™!xà ø K$€™!xà ø J$€™!xà ø I$€™!xà ø H$€™!xà ø G$€™!xà ø F$€™!xà ø E$€™!xà ø D$€™!xà ø C$€™!xà ø B$€™!xà ø A$€™!xà ø @$€™!xà ø ?$€™!xà ø >$€™!xà ø =$€™!xà ø <$€™!xà ø :$€™!xà ø 9$€™!xà ø 8$€™!xà ø 7$€™!xà ø 6$€™!xà ø 5$€™!xà ø 4$€™!xà ø 3$€™!xà ø 2$€™!xà ø 1$€™!xà ø 0$€™!xà ø /$€™!xà ø .$€™!xà ø ,$€™!xà ø +$€™!xà ø *$€™!xà ø ($€™!xà ø '$€™!xà ø &$€™!xà ø %$€™!xà ø $$€™!xà ø "$€™!xà ø !$<`œ'!à™àÿœ'Œ¯¿¯Œ¯<<œ'!àŸ$€™ :9' ø Œ¿à œ'ipstatusexpirecallerid_namecallerid_numcodecscodec[This paragraph is Copyright (C) 2000, Linux Support Services, Inc. In order for your module to load, it must return this key via a function called "key". Any code which includes this paragraph must be licensed under the GNU General Public License version 2 or later (at your option). Linux Support Services, Inc. reserves the right to allow other parties to license this paragraph under other terms as well.chan_iax2.cI should never be called! Hanging up. New max nontrunk callno is %d New max trunk callno is %d Can't compress subclass %d *UNREACHABLELAGGED (%d ms)OK (%d ms)UNKNOWNUnmonitoredcalc_timestamp: call %d/%d: Timestamp slaved to delivery time predicted timestamp skew (%u) > max (%u), using real ts instead. Encoding full frame %d/%d with length %d Encoding full frame %d/%d with length %d + %d padding (15=%02x) Encoding mini frame with length %d Sending %d on %d/%d to %s:%d Call number = %d Received error: %s Created trunk peer for '%s:%d' Uh, this isn't a good sign... No private structure for packet? Out of memory Supposed to send packet encrypted, but no key? Expanded trunk '%s:%d' to %d bytes Insufficient memory to expand trunk data to %s:%d Maximum trunk data space exceeded to %s:%d Transferring '%s' to '%s' Indicating condition %d Answering IAX2 call Write error: %s -- Can't masquerade, we're different... -- Operating with different codecs %d[%s] %d[%s] , can't native bridge... Unable to start the transfer Usecnt < 0??? TimeoutRegistration RefusedNo authority foundAvoiding IAX destroy deadlock We're hanging up %s now... Really destroying %s now... -- Hungup '%s' Can't make trunk once a call has started! Call %d is already a trunk Unable to trunk call: Insufficient space Made call %d into trunk call %d @:[]/Noop&Auto-congesting call due to slow response Max retries exceeded to host %s on %s (type = %d, subclass = %d, ts=%d, seqno=%d) aes128rsamd5plaintextOut of memory! Socket: %s Can't bind: %s Non-local or unbound address specified (%s) in sourceaddress for '%s', reverting to default Unable to bind to sourceaddress '%s' for '%s', reverting to default Using sourceaddress %s for '%s' secretmailboxdbsecretmailboxdetailtrunkUnable to support trunking on peer '%s' without zaptel timing authencryptionnotransferjitterbufferforcejitterbufferhostdynamic255.255.255.255defaultipsourceaddresspermitdenymaskregextenpeercontextusernameallowdisallowcalleridsendaniinkeysoutkeyqualifynoyesQualification of peer '%s' should be 'yes', 'no', or a number of milliseconds at line %d of iax.conf qualifysmoothingqualifyfreqokQualification testing frequency of peer '%s' when OK should a number of milliseconds at line %d of iax.conf qualifyfreqnotokQualification testing frequency of peer '%s' when NOT OK should be a number of milliseconds at line %d of iax.conf Set peer->pokefreqnotok to %d timezonePeer '%s' is now UNREACHABLE! Time: %d PeerStatusPeer: IAX2/%s PeerStatus: Unreachable Time: %d IAX2/%sAsked to authenticate to %s with an RSA key, but they don't allow RSA authentication No challenge provided for RSA authentication to %s Unable to find private key '%s' Unable to sign challenge withy key %2.2xNo way to send secret to peer '%s' (their methods: %d) Decoding full frame with length %d (padding = %d) (15=%02x) Decoding mini with length %d ;Parked on extension '%d' schedule_delivery: pushed forward timestamp schedule_delivery: pushed back timestamp calc_rxstamp: call=%d: rxcore set to %d.%6.6d - %dms calc_rxstamp: call=%d: works out as %d.%6.6d IAX2 JB interpolationiaxpeersipaddrregsecondsExpiring registration for peer '%s' IAX/Registry%s:%dCreating new call structure %d Out of resources No more space Still have a callno... Unable to allocate call for poking peer '%s' -- Seeding '%s' at %s:%d for %d typefriendpeerrealtime_peer: Bah, '%s' is expired (%d/%d/%d)! realtime_peer: Registration for '%s' still active (%d/%d/%d)! Checking device state for device %s iax2_devicestate: Found peer. What's device state of %s? addr=%d, defaddr=%d maxms=%d, lastms=%d Memory Error! CURRENTCHANNELSending registration request for '%s' Allocate call number Unable to create call for registration Registration created on call %d IAX2/%s-%dUnable to start PBX on %s IAX2 Trunk Debugging Disabled IAX2 Debugging Disabled IAX2 Jitterbuffer Debugging Enabled IAX2 Trunk Debug Requested IAX2 Debugging Enabled %-25.25s %4d %4d %4d %5d %3d %5d %4d %6d %4d %4d %5d %3d %5d %4d %6d %s %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d (None) -------- LOCAL --------------------- -------- REMOTE -------------------- Channel RTT Jit Del Lost %% Drop OOO Kpkts Jit Del Lost %% Drop OOO Kpkts %d active IAX channel%s %-20.20s %-10.10s %-20.20s %8.8s %s HostUsernamePerceivedRefreshStateNo AuthenticationUnknownUnregisteredRequest SentAuth. SentRegisteredRejected%-20.20s %-10.10s %-20.20s %8d %s %-15.15s %-15.15s %-15.15s DeviceVersionSize%-15.15s %-15d %-15d sorry, this command is deprecated IAX2 Jitterbuffer Debugging Disabled registeredlike%-15.15s %-15.15s %s %-15.15s %-8s %s %-10s%sName/UsernameMaskPort(Unspecified)(D)(S)(T)(E)%-15.15s %-15.15s %s %-15.15s %-5d%s %s %-10s%s%d iax2 peers [%d online, %d offline, %d unmonitored]%s%s/%s IAX Statistics --------------------- Outstanding frames: %d (%d ingress, %d egress) Packets in transmit queue: %d dead, %d final, %d total IAXpeersIAXnetstatschan_iax2: Sent %d queued outbound frames all at once chan_iax2: ast_io_wait ran %d I/Os all at once chan_iax2: ast_sched_runq ran %d scheduled tasks all at once Beginning trunk processing. Trunk queue ceiling is %d bytes per host Unable to read from timing fd - Trunk peer (%s:%d) has %d call chunk%s in transit, %d bytes backloged and has hit a high water mark of %d bytes Dropping unused iax2 trunk peer '%s:%d' Ending trunk processing with %d peers and %d call chunks processed /tmp/%s-%ldFailed to stat '%s': %s Cannot open '%s': %s Cannot open '%s' for writing: %s Only read %d of %d bytes of data :(: %s Only write %d of %d bytes of data :(: %s Unable to read firmware header in '%s' '%s' is not a valid firmware file Invalid data length in firmware '%s' No or invalid device type specified for '%s' mmap failed: %s Firmware file '%s' fails checksum %s/firmware/iax == Loaded firmware '%s' Error opening firmware directory '%s': %s load * Name : %s Secret : %s Context : %s Mailbox : %s YesNo Dynamic : %s Callerid : %s Expire : %d ACL : %s Addr->IP : %s Port %d Defaddr->IP : %s Port %d Username : %s Codecs : Codec Order : (none Status : OnOff Qualify : every %dms when OK, every %dms when UNREACHABLE (sample smoothing %s) Peer %s not found. %-20.20s %-12.12s %-9.9s %-8.8s %s Peer/ContextExtenExp.Wait.FlagsEXISTS|NONEXISTENT|CANEXIST|PENDING|TIMEOUT|TRANSMITTED|MATCHMORE|UNKNOWN|(none)%-20.20s %-12.12s %-9d %-8d %s %-20.20s %-12.12s %-9.9s %-8d %s (expired)No such host: %s Unable to retrieve database password for family/key '%s'! peer: %s, username: %s, password: %s, context: %s Unable to create call TBDDP still has peer field or pending or callno (flags = %d, peer = %p callno = %d) Unable to generate call for '%s' No more waiter positions available Unable to create pipe for comm Timeout waiting for %s exten %s asdfDIALSTATUSIAX2/%s/%s@%sIAX2/%s/%s -- Executing Dial('%s') Can't execute nonexistent extension '%s[@%s]' in data '%s' DialNo dial application registered Unable to make DP cache No peer given Unable to create translator path for %s to %s on %s Provisioning '%s' from template '%s' No provisioning found for template '%s' forcedUnable to find peer/address '%s' No template (including wildcard) matching '%s' , forcedProvisioning '%s' with template '%s'%s si-%sService identifier '%s', we think '%08x', they think '%08x' Channel is already in use (%s)? No address associated with '%s' %-15.15s %-20.20s %-15.15s %-15.15s %-5.5s %-5.10s SecretAuthenDef.ContextA/CCodec Pref-no secret-REQ OnlyDisabledCaller%-15.15s %-20.20s %-15.15d %-15.15s %-5.5s %-5.10s Key: %-15.15s ActionID ActionID: %s %-20.20s %-15.15s %-10.10s %-11.11s %-11.11s %-7.7s %-6.6s %-6.6s %s ChannelPeerID (Lo/Rem)Seq (Tx/Rx)LagJitterJitBufFormat%-20.20s %-15.15s %-10.10s %5.5d/%5.5d %5.5d/%5.5d %-5.5dms %-4.4dms %-4.4dms %-6.6s requested inkey '%s' for RSA authentication does not exist Empty registration from %s No registration for peer '%s' (from %s) Peer '%s' is not dynamic (from %s) Host %s denied access to register peer '%s' requested inkey '%s' does not exist Host %s failed RSA authentication with inkeys '%s' Host '%s' trying to do RSA authentication, but we have no inkeys Host %s did not provide proper plaintext password for '%s' Host %s failed MD5 authentication for '%s' (%s != %s) Inappropriate authentication received defaultCan't provision a non-IAX device! Can't provision something with no IP? -- Provisioned IAXY at '%s' with '%s'= %d setvarUnable to support trunking on user '%s' without zaptel timing codecprioritycallerdisabledreqonlyaccountcodelanguageamaflagsInvalid AMA Flags: %s at line %d maxauthreqUnable to load config %s generaltosInvalid tos value, should be 'lowdelay', 'throughput', 'reliability', 'mincost', or 'none' bindportIgnoring bindport on reload pingtimenochecksumsmaxjitterbufferresyncthresholdmaxjitterinterpsjittershrinkratemaxexcessbufferminexcessbufferlagrqtimedropcountmaxregexpireminregexpirebindaddrIgnoring bindaddr on reload Unable apply binding to '%s' at line %d == Binding IAX2 to '%s' == Binding IAX2 to '%s:%d' authdebugdelayrejectrtcachefriendsrtignoreregexpirertupdatetrunktimestampsrtautocleartrunkfreqautokillNice try, but autokill has to be >0 or 'yes' or 'no' at line %d bandwidthlowmediumhighbandwidth must be either low, medium, or high registerFormat for registration is user[:secret]@host[:port] at line %d%s is not a valid port number at line %d Host '%s' not found at line %d iaxcompatregcontextInvalid tos value at line %d, should be 'lowdelay', 'throughput', 'reliability', 'mincost', or 'none' 0.0.0.0Unable to create network socket: %s == Binding IAX2 to default address 0.0.0.0:%d Could not allocate outsock list. Minimum registration interval of %d is more than maximum of %d, resetting minimum to %d userUnknown type '%s' for '%s' in %s Section '%s' lacks type Could not allocate netsock list. List IAX PeersShow IAX Netstatsiax.confUnable to register channel class %s Unable to register IAX switch == IAX Ready and Listening Unable to start network thread allOK cache is flushed. OK peer %s was removed from the cache. SORRY peer %s is not eligible for this operation. SORRY peer %s was not found in the cache. Peer '%s' has too new a protocol version (%d) for me iaxusersError: %s midget packet received (%d of %zd min) Rejecting packet from '%s.%d' that is flagged as a video frame but is too short midget meta trunk packet received (%d of %zd min) Unable to accept trunked packet from '%s:%d': No matching peer Unknown meta trunk cmd from '%s:%d': dropping IAX2For call=%d, set last=%d Datalen < 0? Received trunked frame before first full voice frame Rejecting packet from '%s.%d' that is flagged as a full frame but is too short Raw Hangup %s:%d, src=%d, dst=%d Packet Decrypt Failed! Received packet %d, (%d, %d) Packet arrived out of order (expecting %d, got %d) (frametype = %d, subclass = %d) Acking anyway Cancelling transmission of packet %d Really destroying %d, having been acked on final message Received iseqno %d not within window %d->%d Undecodable frame received from '%s' Ooh, voice format changed to %d Neat, somebody took away the channel at a magical time but i found it! Ooh, video format changed to %d IAX subclass %d received HoldChannel: %s Uniqueid: %s UnholdRejected connect attempt from %s, who was trying to reach '%s@%s' No such context/extensionRejected connect attempt from %s, request '%s@%s' does not exist mineUnable to negotiate codecRejected connect attempt from %s, requested 0x%x incompatible with our capability 0x%x. Rejected connect attempt from %s, requested/capability 0x%x/0x%x incompatible with our capability 0x%x. No best format in 0x%x??? -- Accepting UNAUTHENTICATED call from %s: %srequested format = %s, %srequested prefs = %s, %sactual format = %s, %shost prefs = %s, %spriority = %s > -- Accepted unauthenticated TBD call from %s Unauthenticated call limit reachedUnable to start lookup thread! Immediately destroying %d, having received hangup Call rejected by %s: %s Immediately destroying %d, having received reject Parking/%sIAXPeer/%sMasquerade failed :( Failed to park call on '%s' Parked call on '%s' Async goto of '%s' to '%s@%s' failed Async goto of '%s' to '%s@%s' started Async goto not applicable on call %d -- Call accepted by %s (format %s) Rejected call to %s, format 0x%x incompatible with our capability 0x%x. -- Format for call is %s Peer '%s' is now REACHABLE! Time: %d Peer: IAX2/%s PeerStatus: Reachable Time: %d Peer '%s' is now TOO LAGGED (%d ms)! Peer: IAX2/%s PeerStatus: Lagged Time: %d Peer lastms %d, historicms %d, maxms %d LAGRQPeer %s lag measured as %dms Call on %s is already up, can't start on it I don't know how to authenticate %s to %s Host %s failed to authenticate as %s We don't do requested format %s, falling back to peer capability %d -- Accepting AUTHENTICATED call from %s: %srequested format = %s, %srequested prefs = %s, %sactual format = %s, %shost prefs = %s, %spriority = %s -- Accepted AUTHENTICATED TBD call from %s Rejected dial attempt from %s, request '%s@%s' does not exist -- Accepting DIAL from %s, formats = 0x%x Immediately destroying %d, having received INVAL Destroying call %d Received VNAK: resending outstanding frames No such peer '%s' %s:%d:%dAUTHENTICATEDUNAUTHENTICATED -- Registered IAX2 '%s' (%s) at %s:%d Peer: IAX2/%s PeerStatus: Registered -- Unregistered IAX2 '%s' (%s) Peer: IAX2/%s PeerStatus: Unregistered Restricting registration for peer '%s' to %d seconds (requested %d) Registry error Registry acknowledge on unknown registry '%s' Received unsolicited registry ack from '%s' with message(s) waiting with %d messages waiting with 1 message waiting with no messages waiting -- Registered IAX2 to '%s', who sees us as %s%s Channel: IAX2 Domain: %s Status: Registered Registration failure Registration of '%s' rejected: '%s' from: '%s' Channel: IAX2 Username: %s Status: Rejected Cause: %s Received unsolicited registry authenticate request from '%s' No secret associated with peer '%s' Can't reregister without a reg -- Channel '%s' unable to transfer -- Channel '%s' ready to transfer -- Releasing %s and %s Invalid transfer request Peer did not understand our iax command '%d' Unknown IAX command %d on %d/%d Received mini frame before first full video frame Received mini frame before first full voice frame Received out of order packet... (type=%d, subclass %d, ts = %d, last = %d) IAXPEERGets IAX peer informationIf peername specified, valid items are: - ip (default) The IP address. - status The peer's status (if qualify=yes) - mailbox The configured mailbox. - context The configured context. - expire The epoch time of the next expire. - dynamic Is it dynamic? (yes/no). - callerid_name The configured Caller ID name. - callerid_num The configured Caller ID number. - codecs The configured codecs. - codec[x] Preferred codec index number 'x' (beginning with zero). If CURRENTCHANNEL specified, returns IP address of current channel IAXPEER([:item])iax2setjitterSets IAX jitter buffershowDisplay IAX statisticscacheDisplay IAX cached dialplanShow details on specific IAX peerprunerealtimePrune a cached realtime lookupreloadReload IAX configurationusersShow defined IAX usersfirmwareShow available IAX firmwaresShow active IAX channelsShow active IAX channel netstatspeersShow defined IAX peersregistryShow IAX registration statusEnable IAX debuggingEnable IAX trunk debuggingjbEnable IAX jitterbuffer debuggingDisable IAX debuggingDisable IAX trunk debuggingDisable IAX jitterbuffer debuggingtestlosspctSet IAX2 incoming frame loss percentageprovisionProvision an IAX deviceIAX2ProvisionProvision a calling IAXy with a given template IAX2Provision([template]): Provisions the calling IAXy (assuming the calling entity is in fact an IAXy) with the given template or default if one is not specified. Returns -1 on error or 0 on success. IAX Remote Dialplan Switchìùÿøùÿ‘ùÿ‘ùÿ‘ùÿ(‘ùÿԐùÿ`GúÿTcúÿšdúÿxšúÿ°Wúÿ8XúÿÜ^úÿHiúÿÈlúÿ”{úÿhúÿhúÿü|úÿ€Œúÿ,‡úÿ‹úÿü|úÿ8|úÿVúÿT–úÿyúÿܒúÿ”úÿFúÿPúÿd”úÿ€úÿXDúÿ0Eúÿcúÿ€™úÿ€™úÿԗúÿìYúÿ€™úÿ˜úÿfunction_iaxpeerIAX2iax2_transfer__send_commandiax2_sendcalc_timestampcompress_subclassiax2_trunk_queuefind_tpeerencrypt_framesend_packetiax2_setoptioniax2_fixupiax2_indicateiax2_bridgeiax2_writeiax2_readiax2_answeriax2_hangupiax2_predestroyiax2_destroyupdate_max_trunkiax2_callcreate_addrauto_congestiax2_devicestateiax2_requestfind_callnorealtime_peerbuild_peerpeer_set_srcaddrcheck_srcaddrsocket_readraw_hangupdecode_framecheck_accessbuild_userspawn_dp_lookupiax_parkiax_park_threadauthenticateauthenticate_verifyregister_verifyupdate_registryiax2_poke_peeriax2_poke_noanswercheck_provisioningiax2_provisionregistry_authrequestiax2_ack_registryiax2_do_registerregistry_rerequesttry_transfercomplete_transferunwrap_timestampcalc_rxstampexpire_registryupdate_max_nontrunkmake_trunkast_iax2_newInter Asterisk eXchange (Ver 2)load_moduleiax2_matchmorefind_cachecache_get_callno_lockediax2_execiax2_canmatchiax2_existsset_configiax2_registernetwork_threadattempt_transmittiming_readtransmit_trunkreload_firmwaretry_firmwareiax2_prov_appjb_warning_outputjb_error_outputiax_error_outputInter Asterisk eXchange Driver (Ver 2)Y@>Unknown IEAttempt to double free frame detected WARNING: %sOut of space for ie '%s' (%d), need %d have %d RDRxTxTE%03d No(%d?)%c%s-Frame Retry[%s] -- OSeqno: %3.3d ISeqno: %3.3d Type: %s Subclass: %s Timestamp: %05lums SCall: %5.5d DCall: %5.5d [%s:%d] Total IE length of %d bytes exceeds remaining frame length of %d bytes %d bytesPresent Unknown IE %03d : Present IPV4 %s:%dInvalid AddressTotal Prov IE length of %d bytes exceeds remaining prov frame length of %d bytes %-15.15s : %s Unknown Prov IE %03d : Present ,8khz,11.025khz,16khz,22.05khz,44.1khz,48khzNone Specified! Invalid SHORTInvalid IPADDRInvalid BYTE%Y-%m-%d %TInvalid DATETIME format!%luInvalid INT%lu (%s)Information element length exceeds message size Expecting capability to be %d bytes long but was %d Expecting format to be %d bytes long but was %d Expecting version to be %d bytes long but was %d Expecting adsicpe to be %d bytes long but was %d Expecting samplingrate to be %d bytes long but was %d Expecting authmethods to be %d bytes long but was %d Expecting encryption to be %d bytes long but was %d Expecting refresh to be %d bytes long but was %d Expecting dpstatus to be %d bytes long but was %d Expecting callno to be %d bytes long but was %d Expecting causecode to be single byte but was %d Expected single byte Unknown command, but was %d long Expecting msgcount to be %d bytes long but was %d Expecting transferid to be %d bytes long but was %d Expecting date/time to be %d bytes long but was %d Expecting firmwarever to be %d bytes long but was %d Expected block desc to be %d bytes long but was %d Expected provisioning version to be %d bytes long but was %d Expected single byte callingpres, but was %d long Expected single byte callington, but was %d long Expecting callingtns to be %d bytes long but was %d Expected jitter rr to be %d bytes long but was %d Expected loss rr to be %d bytes long but was %d Expected packets rr to be %d bytes long but was %d Ignoring unknown information element '%s' (%d) of length %d Invalid information element contents, strange boundary (0?)HANGUP RING RINGINGANSWER BUSY TKOFFHKOFFHOOKNEW PING PONG ACK REJECT ACCEPT AUTHREQAUTHREPINVAL LAGRQ LAGRP REGREQ REGAUTHREGACK REGREJ REGREL VNAK DPREQ DPREP DIAL TXREQ TXCNT TXACC TXREADYTXREL TXREJ QUELCH UNQULCHPOKE PAGE MWI UNSPRTDTRANSFRPROVISNFWDWNLDFWDATA DTMF VOICE VIDEO CONTROLNULL IAX TEXT IMAGE HTML CNG CALLED NUMBERCALLING NUMBERANICALLING NAMECALLED CONTEXTUSERNAMEPASSWORDCAPABILITYFORMATLANGUAGEVERSIONADSICPEDNIDAUTHMETHODSCHALLENGEMD5 RESULTRSA RESULTAPPARENT ADDRESSREFRESHDIALPLAN STATUSCALL NUMBERCAUSEUNKNOWN IAX CMDMESSAGE COUNTAUTO ANSWER REQTRANSFER IDREFERRING DNISPROVISIONINGAES PROVISIONGDATE TIMEDEVICE TYPESERVICE IDENTFIRMWARE VERFW BLOCK DESCFW BLOCK DATAPROVISIONG VERCALLING PRESNTNCALLING TYPEOFNUMCALLING TRANSITNETSAMPLINGRATECAUSE CODEENCRYPTIONENCRYPTION KEYCODEC_PREFSRR_JITTERRR_LOSSRR_PKTSRR_DELAYRR_DROPPEDRR_OUTOFORDERUSEDHCPSUBNETGATEWAYBINDPORTTYPEOFSERVICEFLAGSAESKEYSERVERIPSERVERPORTNEWAESKEYPROV VERSIONALTSERVERIPÀºúÿкúÿàºúÿðºúÿ»úÿ»úÿ »úÿ@»úÿ˜»úÿŒúÿ$ŒúÿpŒúÿœúÿ œúÿžœúÿÈœúÿØœúÿèœúÿøœúÿ@ŸúÿˆŸúÿПúÿ¿úÿ0¿úÿ|¿úÿŒ¿úÿœ¿úÿœúÿ8Äúÿ8Äúÿô¿úÿ€ÀúÿŽÀúÿLÀúÿÄÀúÿÁúÿDÁúÿšÁúÿèÁúÿÂúÿžŒúÿàŸúÿlœúÿ0Áúÿ0»úÿ`ÂúÿžÂúÿÃúÿTÃúÿœÃúÿàÃúÿiaxprov.confiax2-provision.ctemplateUnable to find base template '%s' for creating '%s'. Trying '%s' Unable to locate default base template '%s' for creating '%s', omitting. serverportIgnoring invalid %s '%s' for '%s' at line %d serveraltserverIgnoring invalid codec '%s' for '%s' at line %d lowdelaythroughputreliabilitymincostTruncating username from '%s' to '%s' for '%s' at line %d passTruncating password from '%s' to '%s' for '%s' at line %d Truncating language from '%s' to '%s' for '%s' at line %d flagsUnknown keyword '%s' in definition of '%s' at line %d -- Loaded provisioning template '%s' No IAX provisioning configuration found, IAX provisioning disabled. iax/provisioning/cachev0x%08xuv%xUnable to create provisioning packet for '%s' Retrieved cached version '%s' = '%08x' ,== %s == Base Templ: %s Username: %s Secret: %s Language: %s Bind Port: %d Server: %s Server Port: %d Alternate: %s Flags: %s Format: %s TOS: %d No provisioning templates found No provisioning template matching '%s' found provisioningShow iax provisioningsecureheartbeatdisableciddisablecwdisablecidcwdisable3wayiax_provision_reloadiax_process_templateiax_template_parseiax_provision_versionàÁÿÿÿÿÿÿÿÿ šŒŸÿÿ %ÕcÐ.\až<hdšbLbøaÈh€` P$f_hd¬–Œ–ì–ؓ”Ĕœš€š¬šŽšŒšÄšÌšÔšœšÜšäšìšôš€šüš© ©©©$©,©4©<©D©L©T©\©d©l©t©|©„©Œ©”©œ©€©¬©Ž©Œ©Ä©Ì©Ô©Ü©ä©ì©ô©œšü©ª ªªª$ª,ª4ª<ªDªLªš\ªšlªšpªš€ªšªšœªššªX ŽªX Œªš ȪÜ ЪÜ تšàªÜ쪚øªš«š«Œ$«Ü,«Ü<«ÜH«šP«$`«Üp«€«XŒ«šœ«Ð¬«Œ«p È«š!Ô«š"ä«Ü#ô«X$¬%¬X&$¬$'4¬$(H¬Ü)\¬¬ *l¬$+x¬Ü,„¬-”¬ . ¬X/¬¬X0ެX1Œ¬Ü2ȬX3Ô¬X䬄¢h ì¬h ô¬h ü¬Üªšœªš Œªš ­$ ­Ì ŽªX ­(­h 4­Ü@­L­X\­h H{ŽŽ If used with a callid, it sets the jitter buffer to the given static value (until its next calculation). If used without a callid, the value is used to establish the maximum excess jitter buffer that is permitted before the jitter buffer size is reduced.Usage: iax show stats Display statistics on IAX channel driver. Usage: iax show cache Display currently cached IAX Dialplan results. Usage: iax show peer Display details on specific IAX peer Usage: iax2 prune realtime [|all] Prunes object(s) from the cache Usage: iax2 reload Reloads IAX configuration from iax.conf Usage: iax2 show users [like ] Lists all known IAX2 users. Optional regular expression pattern is used to filter the user list. Usage: iax2 show firmware Lists all known IAX firmware images. Usage: iax2 show channels Lists all currently active IAX channels. Usage: iax2 show netstats Lists network status for all currently active IAX channels. Usage: iax2 show peers [registered] [like ] Lists all known IAX2 peers. Optional 'registered' argument lists only peers with known addresses. Optional regular expression pattern is used to filter the peer list. Usage: iax2 show registry Lists all registration requests and status. Usage: iax2 debug Enables dumping of IAX packets for debugging purposes Usage: iax2 trunk debug Requests current status of IAX trunking Usage: iax2 jb debug Enables jitterbuffer debugging information Usage: iax2 no debug Disables dumping of IAX packets for debugging purposes Usage: iax2 no trunk debug Requests current status of IAX trunking Usage: iax2 no jb debug Disables jitterbuffer debugging information Usage: iax2 test losspct For testing, throws away percent of incoming packets Usage: iax2 provision