ELF`@4P4 p“““@@@@@k Œ"ĢĢ̟O/²`ŪM[ Ō? pҼ|Ģ Ÿ p[“2 ppp p(p;p$p ž’’o”2’’’oš’’o0;*5Ś“šwf‚z0¬#ĘĻQP!į29(oÆ÷N\*@Xn1ām6¤³Ćū%0 ZJü½ÅWMŻVs»²83Óä|…š¹±­.Ų!Ä gFŹ>IŸå• hŅ Ā‹ļ`ŠŃ”ÜŖ3DSŁœjŒ‰”ŠGa:›"©Į}#§[T™L/’iž,e¾~'4ČRkĖ+ƒ-bu®žU?]ŽH7C<yż)ģ† ¢%ńr&źKĶ '=t‘€£’ YAÕĒ:(q$ŗcˆOÖ_;B^µ„/+ؖE¼īdŽpć«„‡—·vąlĢ˜{$ ōxø°æ-č“."ß¶×öķ9ēõ&¦é2ĄĪųÉęŪŌó4ņ5śłė167,)8Ō?`@ PĆ pŅ ŠŅ @ @ @,@0@PE|`€`°`lPE`Ūń’s`Ūń’mŌ?¹ˆ`e`@ ŒŒ`~€`ń’ pŅ t”`w€`ń’p[ń’ bń’™˜`Š€`ń’Äœ`© `,PŅ»@Ņ! 0Ņ]8D ŅūŅT‰ŅnšŃ¤ąŃÖ ŠŃUĄŃ!°Ń× Ńc #Ń*€Ń¾ pŃŲkl} ˜ `Ń« PŃš@ŃŒQ0Ńä§ ŃĆŃœ Ńl šŠjąŠ ‡ŠŠ¦ŌĄŠĶ °Š‰ Š„Šį€Š~ pŠņ`Š PŠ™@Ф0ŠĪ Š>ŠZŠńšĻMąĻŹŠĻ€ ĄĻń °Ļ ϳĻĖ€Ļ˜pĻ7 `ĻBPĻ+@Ļļ0Ļz ϐŒĻĻČšĪVąĪ–ŠĪ7ĄĪ=°Ī14± Ռ~ ÷  Īų Ī¼ @Oę€Ī€ pĪČ`ĪtPĪ“ū @Īq0ĪŚqč“ˆ  Ą ĪŪĪLßĪļXHƒl «` šĶwąĶ,‡ ŠĶJĄĶÜ“ƒ  °Ķ®  Ķ„ ĶX»€ĶŌE pĶm`Ķ PĶŚ @Ķ0Ķ Ķ ¤`ć ĶŠĶ¼Š`šĢ“ąĢK ŠĢÉĄĢż°ĢT³ Ģäé Ģ²€Ģ £pĢv`Ģ;PĢtH @Ģš 0Ģ[ Ģ“ ĢHĢéšĖą ąĖ Ļą|\ öŠĖDĄĖ°ĖÉ ĖĖź ų  Č €ĖpĖ ż`ĖTPĖb@ĖQ0ĖQ ĖęĖ) ĖźšŹ|~ąŹhŪŠŹTöĄŹČ}°Ź= ŹT"Ź €Ź7pŹs¶ `ŹāPŹäĻ@Ź[ 0Źž Źč Ź)ŹBšÉžąÉ- ŠÉ ĄÉlž°Éw É< É=€É1pÉTž`É0¶ PÉį@ÉDŠ 0Éü É9ÉfÉT5"r šČœ6ąČ ŠČ@ōŸø  ĄČ+°Čl Čr ¬«H fČ€Č=pČ`ČĻ PČš@ČŅ0Č ČČp‘ Č|“šĒŽ ąĒiT} Ō TÆą „ ŠĒX8ĄĒ– ‹ °Ē… ĒĒ Ēµ¶ €Ē×pĒ\ `ĒōPĒT@Ēp 0Ēż ĒøĒŠœ} %ǼšĘüąĘćŠĘŃĄĘ °Ęz„} h Ę|¬‚d aĘ·„`” €Ę.pĘv`Ę@ öPĘV@Ę%0Ęm ‚@ + ĘćØD &"šĘĘĀšÅĒ ąÅĒŠÅ4‹ĄÅH²` _°Åć Å Å$€ÅĀ ģ€  ŗpÅxL`ÅZ<} W“}° ćPÅM"Ŗ @Å0Å· Å"ũŠ€`Š šÄTK ąÄbŠÄ@SĄÄ6°Ä ÄÄH*€Äś pĘ`ÄžPÄj@ÄŒ0Ä< ÄŗÄ® ō«` ^ ÄēšĆd ąĆĮŠĆlųĄĆé{°Ć˜ Ć5 ĆI€ĆBpĆŪX‚T " `Ć«PĆ Čƒ _GLOBAL_OFFSET_TABLE__gp_disp_fini__cxa_finalize__deregister_frame_info__register_frame_info_Jv_RegisterClassesstrcmpstrcasecmpast_copy_stringatoiast_logast_null_frameoption_debugpthread_mutex_lockiax_frame_newiax_frame_wrapast_tvzerogettimeofdayast_tvdiff_msast_tvnowast_samp2tvast_tvsubast_tvaddpthread_cond_signalpthread_mutexattr_initpthread_mutexattr_settypepthread_mutex_initpthread_mutexattr_destroymemsetaes_encryptmemcpyast_inet_ntoaiax_showframesendto__errno_locationstrerrorpthread_mutex_unlocksetsockopt_ast_callocpthread_kill_ast_reallocstrchriax_ie_append_strstrlen_ast_mallocast_moh_startast_moh_stopast_verbosepthread_mutex_trylockusleeprandomiax_ie_append_addriax_ie_append_shortoption_verboseast_getformatname_multipleiax_ie_append_intast_waitfor_nast_readast_check_hangupast_frame_freeast_writeao2_refstrsepast_strip_quotedast_dnsmgr_lookupast_trueast_free_haast_variables_destroyast_sched_delao2_unlinkstrstrast_get_ipsocketcloseast_netsock_findast_netsock_sockfdast_netsock_bindast_netsock_unrefao2_findao2_alloc__ast_string_field_init__ast_string_field_empty__ast_string_field_alloc_spacestrcpyinet_atonast_append_haast_parse_allow_disallowast_callerid_splitsscanfpthread_cond_initpthread_attr_initpthread_attr_setdetachstateast_pthread_create_stackast_atomic_fetchadd_intpthread_cond_timedwaitaes_encrypt_key128aes_decrypt_key128ast_key_getast_signMD5InitMD5UpdateMD5Finalsprintfaes_decryptast_queue_control_dataao2_iterator_initstrncasecmpao2_iterator_next_ast_strdupast_matchmore_extensionast_parking_extast_exists_extensionast_canmatch_extensionast_ignore_patternast_park_callast_hangupast_channel_allocast_best_codecpbx_builtin_setvar_helperast_pbx_startast_module_refast_add_extensionast_context_remove_extensionast_localtimeiax_frame_freeast_queue_frameast_update_realtimemanager_eventast_db_delast_device_state_changediax2_regfunkast_sched_addjb_nextast_tvast_codec_get_samplesast_bridged_channeljb_getalljb_resetjb_putjb_getiax_prov_complete_templateast_clijb_setoutputvsnprintfiax_get_framesiax_get_iframesiax_get_oframesjb_getinfoastman_appendregcompregexecregfreepthread_mutex_destroypthread_cond_destroyast_atomic_dec_and_testpthread_testcancelast_io_waitast_sched_waitast_sched_runqast_queue_hangupast_module_unrefiax_ie_append_bytejb_destroyao2_callbackast_dnsmgr_releaseast_db_getast_load_realtimememcmpast_get_time_t__ao2_linkjb_newjb_setconfast_codec_pref_indexast_getformatnameast_dnsmgr_refreshast_dnsmgr_changedast_module_unregisterast_module_registerstrrchrstatopenlseekmunmapmmapast_config_AST_DATA_DIRopendirreaddirclosedirpthread_cancelpthread_joinast_netsock_releaseast_manager_unregisterast_unregister_applicationast_cli_unregister_multipleast_unregister_switchast_channel_unregisteriax_provision_unloadsched_context_destroyast_custom_function_unregisteriaxpeer_functionast_callerid_mergestrncatast_gethostbynameast_codec_pref_convertast_tvcmppipeast_channel_defer_dtmfast_waitfor_nandfdsast_channel_undefer_dtmfpbx_builtin_getvar_helperpbx_findapppbx_execast_translator_best_choiceiax_provision_buildiax_ie_append_rawiax_provision_versioniax_ie_appendast_setstateastman_get_headerast_check_signatureast_variable_newast_cdr_amaflags2int__ast_string_field_index_buildast_config_loadast_variable_browseast_variable_retrieveast_str2tosast_context_findast_context_createast_netsock_list_allocast_netsock_initast_category_browseast_config_destroyao2_container_allocast_custom_function_registeriax_set_outputiax_set_errorio_context_createsched_context_createast_cli_register_multipleast_register_applicationast_manager_register2ast_channel_registerast_register_switchiax_provision_reloadast_shrink_phone_numberast_apply_haast_db_putast_app_inboxcountrecvfromiax_parse_iesast_set_read_formatast_codec_chooseast_codec_pref_stringpthread_attr_destroyast_channel_masqueradeast_do_masqueradeast_async_gotoast_set_write_formatbcopyast_swapcopy_samples_pthread_cleanup_pushpthread_cond_wait_pthread_cleanup_popast_check_signature_binast_sign_binast_encrypt_binast_decrypt_biniax2_stateiax2_flagsiax_ie2strstderrfprintfstdoutfputsstrncpystrcatstrftimeiax_provflags2strtemplatesast_getformatbynameast_db_deltreelibgcc_s.so.1libc.so.0_ftext_fdata_gp_edata__bss_start_fbss_endGLIBC_2.0Mii •|`PE$@@@ODOHOLOPO`OdOhOlOpOtO O¤OØOąOäOčO PPPLPPPTPxP|P€PøP¼PĄPäPčPģP$Q(Q,QPQTQXQQ”Q˜Q¼QĄQÄQüQRR(R,R0RhRlRpR”R˜RœRŌRŲRÜRSSS@SDSHSlSpStS¬S°S“SøSŲSÜSTT TDTHTLT„TˆTŒTT°T“TøTšTōTųTU U$U(U\U`UdUlUˆUŒUU”UČUĢUŠUŲUōUųUüUV4V8V$ ¼L™ ų  $Ž#– ¼’d0¢Æ €‚"% ƒ ƒ™¤ÕB$¤Æ¢ÆÓe&"‡&@$ ų $G ¼€‚P$ŽŲ`CŒT%Ž@<¼„$$b`! …8–‡$’b0%Cƒ ‚ ĄB–’C0%bƒ ‚ –’C0%b‚ ƒ T"ŽB$ĄC–‡$’b0%Cƒ ‚ 8–’C0%b‚ ƒ T"ŽB$T"®P„™PŽ8Ž ų ! ą8ŽT"Žd#Ž!Dc$ ¼T"®d#®$€™U9' ų !  ¼l!0Ž%bPŽś’å$’’$ ®$®ś’ą   –€4’B0€B4’C0%b¢ £ 4ŽŽB0 ’c0% ƒ’‚0"%D£ ¢ 8Ž®B$ ®;®–ü’å$’C0%b’’$ ®$®ü’ć ¢ –’C0%b¢ £ 8Ž®B$ ®®”CŽ $bŽB4®ŒCŽb0@$€™ b0 @ €‡$€™dF&dD&O9' ų  &  ¼ €‚ €…PÕB$ ƒ™¢ÆÓ„$ä!ē$$ ų °$ ¼$€™lR9' ų !  ¼$$ž(°'æü·ų¶ōµš“ģ³č²ä±ą°ą½'P쁂BŒB(@ü„™ €„ ų @ք$ ¼¢ŽP€ƒĄ@#€(€‚$€™€bB$!€HH9' ų !  ¼€€‚$€™€bB$!bbŒ! U9' ų “@¤ ¼€ƒĀŽ0@c$CĄ@#€(€‚$€™€bB$!€HH9' ų !  ¼€€‚$€™€bB$!bbŒ! U9' ų “@¤ ¼nž’$x¦ŽxĀŽ5Ā쁂BŒB(@$€™Č„™L±'!  ų ž$ ¼H°'Ȅ™xʎ!  ų ž$ ¼x„Ž €„xĒŽü„™°Æpք$ ų !0  ¼$€™! `do9' ų !(€ ¼€€ƒ€bc$!CBŒ@“@¤€!CBŒ@$€™“@¤! `Ž!ų ®0€…¼‚™p„$ ų ü$!ˆ@@@ ¼’’$Ü"®Ģ"®€‚x‚™FBŒ<$&¤"® $!0  ų $@ ¼$€™Šx9' ų !  ¼!ˆ@* !š Č Æ$€™ģ~9' ų ! $ ¼`Č¢Æ°$Žļ’<ß’B4$ ‚€‚°$®Ų`CŒ< B4$b%d€‚°#®ģ`BŒš‚“Č"®€‚š`BŒ3®¬"®Č¹* €‚™ ų !  !@ ¼@0Ž3®‚ @™™ ų ! +R@ ¼…™ ! ™E&<$&!0  ų $ ¼@"®…™! @ ų !(  ¼Ł$’"¦€‚\aBŒŠ"®€‚L'&aF$@Č$ŒÌČ ŌĘ$ā¬ć¬ä¬ å¬ö’Čē$€‚°$Ž(FEŒž’$š‚ƒ$ ‚`ź4č"®'$Ō%®ģ"®°$®0#®ō ®#®#®4#®€Š‚™! ą!øĢ Æ…!Ø !°  €…ŽhŲ„$!Č  ų ! @ ¼“Ž!ČĄ! ` ų 2Ž!€@@ ¼š‚‚l"®B‚@™!ČĄ ų ! @+PC@ ¼™&<$&!0  ų $ ¼F"® €…! !Č  ų pŲ„$@ ¼“Ž!ČĄ! ` ų  2Ž!€@@ ¼š‚‚H "®B‚@™!ČĄ ų ! @+P@ ¼™&<$&!0  ų $ ¼" "® €…! !Č  ų xŲ„$@ ¼“Ž!ČĄ! ` ų $2Ž!€@@ ¼š‚‚$$"®B‚@™!ČĄ ų ! @+Pū@ ¼™&<$&!0  ų $ ¼ž$"® €…! !Č  ų ˆŲ„$@ ¼“Ž!ČĄ! ` ų (2Ž!€@@ ¼š‚‚("®B‚@™!ČĄ ų ! @+P×@ ¼™&<$&!0  ų $ ¼Ś("® €…! !Č  ų ”Ų„$@ ¼“Ž!ČĄ! ` ų  2Ž!€@@ ¼š‚‚Ü "®B‚@™!ČĄ ų ! @+P³@ ¼™&<$&!0  ų $ ¼¶ "® €…! !Č  ų  Ų„$ @ ¼ƒ™ ų „Ž ¼@°#Žb4÷’$$b°"®°"ŽB0“@ €‚ €…ØŲB$¢Æ"Ž €‡ ƒ™¢ÆÓ„$#ē$$ ų „#$ ¼°"ކ÷’$ €…! !Č  ų čŲ„$@ ¼$€™¤9' ų „Ž ¼–Ä"® €…! !Č  ų šŲ„$@ ¼$€™č}9' ų „Ž ¼ˆČ"® €…! !Č  ų üŲ„$@ ¼ €‚ €… €‡ ƒ™ŁB$Ó„$#ē$¢Æ$ ų ­#$°#Ž’<’’B4 ¼$b°#®ƒ™ ų „Ž ¼@°#Žb4g°"®Gļ’$ €…! !Č  ų xŁ„$@ ¼ €…Ž„Ł„$!Č  ų ! @ ¼°"Ž’<ļ’c4$C.€<ƒ™ ų !  ¼@°#Ž’<)ļ’B4’<ļ’B4$bŚ’B4 €…! !Č  ų Ł„$ @ ¼ƒ™ ų „Ž ¼@°#ŽĖ’ b4ß’$ €…! !Č  ų  Ł„$@ ¼ƒ™ ų „Ž ¼@°#Ž<¹’%bļ’<’’B4µ’$b €…! !Č  ų “Ł„$4@ ¼ €…„Ž!Č  ų ¼Ł„$ @ ¼°"Ž@B4°"®Č¢!@̹’"–@” ®¶"¦’ ¦Ģ%Ž €‚P‚™ ų paDŒ ¼°#Žæ’$$b’’$Ģ"®°#®Š„™„Ž”%& ų Œ&&@ ¼’"–@̹Ł$’"¦Ģ¹ē `‚™ €„ÄŁ„$ÓØ%& €…! !Č  ų ŌŁ„$@ ¼„‚™…Ž ų “$&Ö@ ¼$€™Šx9' ų !  ¼ !ˆ@ €…! !Č  ų ąŁ„$@ ¼0€™…Ž<€9' ų ! Į ¼ €…! !Č  ų šŁ„$@ ¼ €…! !Č  ų ųŁ„$ @ ¼šƒ™…Žų&Ž ų !  ¼«ų"® €…! !Č  ų Ś„$@ ¼Ģ¢„Ž`‚™B$Ø%&Ģ¢Æ €…! !Č  ų Ś„$@ ¼“Ž!ČĄ! ` ų 2Ž!€@@ ¼š‚‚‹"®B‚@™!ČĄ ų ! @+Pb@ ¼™&<$&!0  ų $ ¼e"® €…! !Č  ų Ś„$@ ¼“Ž!ČĄ! ` ų 2Ž!€@@ ¼š‚‚g"®B‚@™!ČĄ ų ! @+P>@ ¼™&<$&!0  ų $ ¼A"® €…! !Č  ų Ś„$@ ¼“Ž!ČĄ! ` ų 2Ž!€@@ ¼š‚‚C"®B‚@™!ČĄ ų ! @+P@ ¼™&<$&!0  ų $ ¼"® €…! !Č  ų tś„$@ ¼°"ŽD™@B0 @„Ž ų ’’B0’C0 ¼%b¶#¦ ų ’’B0’C0 ¼%b’#¦ €…! !Č  ų  Ś„$@ ¼“Ž!ČĄ! ` ų 2Ž!€@@ ¼š‚‚’"®B‚@™!ČĄ ų ! @+PÖ@ ¼™&<$&!0  ų $ ¼Ł"® €…! !Č  ų ,Ś„$@ ¼`™†ŽL$&Ō%& $ €…! !Č  ų 4Ś„$ @ ¼`™†ŽL$&Ō%&!8 ų Š ¼ €…! !Č  ų @Ś„$I@ ¼„Ž€‚€Ś@€„™°"Žš‚„ž’$$C°"®0$®»4$®š‚‚4"® @™!ČĄ ų ! +R@ ¼…™ ! ™E&<$&!0  ų $ ¼@4"®…™! @ ų („' ¼x³'!ČĄ ų ! `!@ ¼N@00Ž‚@™!ČĄ ų ! +RP@ ¼™E&<$&!0  ų $ ¼Z@0"®…™! @Sx„' €…! !Č  ų LŚ„$@ ¼“Ž`š‚‚b‚œ@š‚‚0#Ž$4"®š‚‚C4"®@™!ČĄ ų ! +R(@ ¼™E&<$&!0  ų $ ¼+4"® €…! !Č  ų XŚ„$4@ ¼“Ž`š‚‚b‚@š‚‚4#Ž0"®$`&°"Žš‚‚0"® @™!ČĄ ų ! +R@ ¼…™!  !(`™E&<$&!0  ų $ ¼0"®@…™…Ž! @ ų  ¼°"ŽĮżB4b€&@°"Žžž’$ €…! !Č  ų dŚ„$ @ ¼ƒ™ ų „Ž ¼@°#ެż€b4ōż’$ €…! !Č  ų lŚ„$@ ¼“Ž!ČĄ! ` ų ,2Ž!€@@ ¼š‚‚,"®B‚@™!ČĄ ų ! @+P×@ ¼™&<$&!0  ų $ ¼Ś,"® €…! !Č  ų tŚ„$@ ¼“Ž!ČĄ! ` ų 2Ž!€@@ ¼š‚‚Ü"®B‚@™!ČĄ ų ! @+P³@ ¼™&<$&!0  ų $ ¼¶"® €…! !Č  ų |Ś„$.@ ¼ €…Ž„Ś„$!Č  ų ! $@ ¼ €…! !Č  ų ˆŚ„$@ ¼Š$±ä"® €…‚™! HŽ„$ ų ä&&$ØC ¼ €‚ €…ŒŚB$¢Æ"Ž €‡¢Æ‚Ž ƒ™¢ÆÓ„$#ē$$ ų $$ ¼–ä ® €…! !Č  ų ōŚ„$@ ¼ƒ™ ų „Ž ¼‰ō"® €…! !Č  ų Ū„$@ ¼ €…‚™„ŽHŽ„$ ų č&&$yC ¼ €‚ €…ŪB$¢Æ"Ž €‡¢Æ‚Ž ƒ™Ó„$#ē$$$$$¢Æ €…! !Č  ų ˆŪ„$(@ ¼ €…‚™„ŽHŽ„$ ų ģ&& ¼$ ƒ™ €…C €‡ €‚Ó„$œŪB$¢Æ"Ž#ē$¢Æ‚Ž$¢Æ($$ ų H ¼ €‚Ó„$ÜB$¢Æģ"Ž#ē$¢Æ$ ų )$$< ¼ €…! !Č  ų 0Ü„$)@ ¼“Ž!ČĄ! ` ų 82Ž!€@@ ¼š‚‚*8"®B‚ @™!ČĄ ų ! @+P@ ¼…™! @ !(`™&<$&!0  ų $ ¼8"®@…™…Ž! @ ų   ¼ €…! !Č  ų <Ü„$@ ¼ƒ™ ų „Ž ¼¬"®”ށū€ €…! ą!ø{ū€™Ä"Ž@$Ä"®°"Žż’$$C°"®$)Ą"¦™ ų ! Ą$ ¼(°'P$!(P$x§' ų ¢Æ ¼!ČĄ ų ! !@ ¼!ž@40Ž"ž‚!ČĄ ų ! `!@ ¼bž@40Žcž‚!ČĄ ų ! `!@ ¼€ž@00ށž‚! ō揚¾ģ·č¶äµą“Ü³Ų²Ō±Š°ąų½'<š@œ'!ą™°‚™ <Ų@œ'!ą™’½'hæÆd³Æ`²Æ\±ÆX°Æ(¼Æ€„$€™HH9' ų  E„$(¼€ƒ˜EpŒ˜Ed$Ž˜Eb¬®‚ŒP€¬€„$€™U9' ų  E„$(¼q!ˆ€„$€™HH9' ų ąE„$(¼€„ŲEƒŒ `ŲE…$bŒŲE‚¬`¬±Œ#X!ˆ`V ¬€’€‚aCŽ,FBŒ*bO@!ˆ €‚ €“„™d#B$¢Æ$Ü$Óf& ų ‹$!ˆ@B@(¼aBŽ$€™l"®$”$&`M9' ų "®(¼!(0€™pš9' ų ¬$&(¼0°'“„™ ų ! (¼! ܀™ ų $(¼Ób&¢Æ €‚,€†P#B$¢Æ’$¢Æ €‚,ƒ™DÜB$ ¢Æ Æ!(DvĘ$h$& ų !8 @(¼¼€™ ų ! (¼!ˆaBŽp„™B$!€ aB®!Č ų (¼ø"ŽB0ł’@$€„$€™U9' ų ąE„$ (¼H‚™¼$&!( ų $(¼! hæd³`²\±X°ąp½'

œ'!ą™Č’½'0æÆ,³Æ(²Æ$±Æ °Æ¼Æ0€™!€ˆš9'!ˆ  ų !˜Ą!€@@¼Č€™ R¬Q¬$®!(`& ų P$¼¬&$€™˜X9' ų ”&¼!€€‘‚™ ų  a& aŽa"Ž b¼ €‚ €… €‡ ƒ™XÜB$¢ÆÓ„$ˆ$ē$$ ų æ$¼ aŽ’’$a"®0æ,³(²$± °!`ą8½'<<=œ'!ą™0’½'ĢæÆČ²ÆÄ±ÆĄ°Æ¼ÆŒ‚Œ<$C"@!€H‚™±'! !(¤$ ų  P޼°Æ€‚€‚™\bDŒ!(  ų $!€@ @¼(„™TD$ ų ’’$¼$€™˜x9' ų ! ¼ŒCŽ’ž<’’B4$bŒC®øEŽ €‚P‚™ ų paDŒ¼¼EŽ’’$ øP®€‚P‚™ ų paDŒ¼ĄEŽ ¼P®€‚P‚™ ų paDŒ¼ÄEŽ ĄP®€‚P‚™ ų paDŒ¼ĢEŽ ÄP®€‚P‚™ ų paDŒ¼äEŽ ĢP®€‚P‚™ ų paDŒ¼äP®ĢæČ²Ä±Ą°ąн'<¤;œ'!ą™€‚€ €bB$! ‚0€™$ž9' „Œ$ß’¢Æš™!  !0/$~`’’$b‚P@’’$z°æ!@"2B‚@"2Lą™!’@ F! d!Č ų !( R&$ö’B ¼ Ąš™ ą0€™! €!(Ą 9' ų !0ą ¼š™!  $¦' @š™!  !0`$ ų  ¼M!L™ ų „Ž ¼¢Æ €ƒ €… €‡ ƒ™`Żc$£Æ±ÆÓ„$8$ē$$ ų \$ ¼9’’$j’@|’! YŒ ų $! @—’@ ¼Š’ €‚"2Ó’@"2Æ’8°' ų !  ¼! @™ ų (±' ¼!(@ȁ™!  ų !0@ ¼! `™ ų !   ¼! ȁ™!(` ų !0@ ¼!(Œƒ™ ų !  ¼!ä™ €‚³'!€ ’XŻQ$°揬·Ø¶¤µ “œ³˜²”±°ąø½'<<7œ'!ą™ø’½'DæÆ@¶Æ<µÆ8“Æ4³Æ0²Æ,±Æ(°Æ¼ÆH‚™°'!€!ˆ ! !˜Ą!($ ų !°ą¼!Øųƒ™(°'!  !(@!Ȁ ų !0Ą¼!(@!  ¢ƒ„$&C¢ ś’„$"Š#Š $Š%Š"š#š$š %šR&¢Æ£Æ ¤Æ$„Æ1&š’s&ā’`! Dæ@¶<µ8“4³0²,±(°ąH½'<$6œ'!ą™°’½'D¾Æ!š HæÆ@¶Æ<µÆ8“Æ4³Æ0²Æ,±Æ(°Æ ¼ÆāŒH‚™B$ĀĄ#č¢!  !ØĄ!°€!(! Ą@$ ų !ą‚’ ܏ĀJ@ ±'FŽĀ,x@’’$0€™“&! ü’Ę$!8Ą$¤9' ų !(` ܏$’ă‚CŒ‚0`P$€‚Ō`BŒ@ €‚CŽ €… €‡ ƒ™˜ŻB$¤Æ¢Æ£Æ°ÆÓ„$”#ē$! ų Ø$ ܏FŽ &+ĀQ@’’$P„™#0ŠF®!(0! ` ų ü’Ę$ ܏ ƒ’$€‚£®ŠAY$$ b …’‚ ų æ¤02 ܏%€!9°® ų !   ܏!3¢®Äƒ‚BŒ@€‚Ō`BŒ@ €‚CŽ €… €‡ ƒ™ŲŻB$¢Æ£ÆÓ„$”#ē$! ų ·$ ܏FŽĀ,@0€™&ž’Ę$!8Ą! $¤9' ų !(#’FŽc0b$+Ā Ü @c$#0ĆP„™F®!(#!  ų ž’Ę$ ܏!’’$!čĄHæD¾@¶<µ8“4³0²,±(°!`ąP½'<|3œ'!ą™@’½'ø¾Æ!š ¼æÆ“·Æ°¶Æ¬µÆØ“Ƥ³Æ ²Æœ±Æ˜°Æ¼Æ€‚€ €bB$!‚DŽÄÅÆŒ‚ŒČĘÆ B0e@ĢĒÆ$Œ™ ų ! C$Ā܏Ą#č£P„™±'!(F$ ų ! ܏Ā'Œƒ™’’$ŁÆĢ™,Ó'!ø ą™ˆĀÆ!° ™ŃÆ!Ø ȁ™!  Ł'8ŒŁÆ!ČĄ ų BŽ܏(PŒ!Č  ų ! ܏!(!0@!Ȁ ų ! `܏!Č  ų ! ܏!0@! `!Ȁ ų !( ܏ŒÄŁ ų !(`܏EŽ0€™ŒÄd¦$ 9' ų d„$܏DŽ0€™ÄŏČʏĢĒ<„9' ų d„$!€@@܏CŽŒbŒ B4Œb¬ €…ˆÄ!Čą ų ųŻ„$!ˆ@܏Į’@! `!čĄ0€™<„9' ų d„$܏!€@!čĄ!¼æø¾“·°¶¬µØ“¤³ ²œ±˜°ąĄ½'<01œ'!ą™Ą’½'<æÆ8¾Æ4·Æ0¶Æ,µÆ(“Æ$³Æ ²Æ±Æ°Æ¼ÆĄ@#b(€‚€ €bB$!ˆb€‚p„™€bB$!€‚$€‚! LoT$$€‚!° UU$$€‚!øĄ!šąHHS$Ž$@<揚BŒ!@xD$!Ȁ ų ¼!  @!Č  ų ¼!Č@ ų $!Č` ų ! é’¼Žˆ™šDŒ!(Ą!0ą ų !8ĄŽ!Č šDŒ ų x„$¼<æ8¾4·0¶,µ(“$³ ²±°!ą@½'<Ų/œ'!ą™’½'læÆh¾Æd·Æ`¶Æ\µÆX“ÆT³ÆP²ÆL±ÆH°Æ¼Æ™!  |§Æ!š  ų !€Ą!Ø@$E¼€‚˜™XbEŒ0¤' ų !0¼!$€‚”ƒ™ŠxW$0¢!  ¢Æ4¢h„™¢Æ8¢!˜  ¢Æ<¢¶'$¢Æ@¢(¢ÆD¢!,¢ÆŽ!Ȁ ų ! ¼@! |£R&*r@!Čą €… €‡°„™! Ó„$Š&ē$ ų ł$¼! $€™Šx9' ų !ˆ@¼!Čą ų ¼!Č` ų ! Ą!€@¼!(ĄŁ’@!0 !ˆ! læh¾d·`¶\µX“T³P²L±H°ąp½'<,.œ'!ą™°ū½'LæÆH¶ÆDµÆ@“Æ<³Æ8²Æ4±Æ0°Æ ¼ÆH‚™!˜Ą! $!(! €(¤'!€ą ų `¶ ¼! €™!(@!0`$ ų °Æ ¼T™ ų !Ø@ ¼! `ü™ ų !(@@ ¼Ģ„™°Æ! !(@!0` ų $ @ ¼˜‚™°Æ! !(@!0` ų $$$ ¼ ˆb$ ™! @ ų !(`@#6 ˆb€"6 ¼ Ą ˆU(€„$€™Ą@#C€b„$HH9' ų ! D ¼€ƒ€€bc$!CBŽ @š™(°'!0`$ ų !  ¼!  …™!0  ų $ ¼!  …™$ ų X$ ¼(¢$€™DŽ¢Æ’’$$$!8°Æšd9' ų ¢Æ ¼ ĄLæ(€„$€™Ą@#b€b„$U9' ų ! d ¼LæH¶Dµ@“<³8²4±0°ąP½'<ģ+œ'!ą™Ų’½'$æÆ °Æ¼Æ!€€0€™„Œ¤Ž&T&4­9' ų  Æ¤Ž€¼¼€™ ų ¼¼€™ ų ! ¼$æ °!ą(½'$ ¼dŽT® d®!ˆ@€…a¢Œ@$€™0¹ ų  Ž ¼#: €„ €…čõ„$„ä„$ £–¤ÆTŽ €™¤ÆXŽ’f0¤Æhē$'24¹%0Ć!(@ ų !8  ¼$€™U9' ų ! ! ¼\Ž!رÖ&>’$€™$€‚€„UP$!Č ų |E„$1` ¼$€™HH9' ų ! ` ¼Äƒ‚BŒ@¼€™L™ ų  dŽc– ¼’d0"% ƒ €ƒ €… €‡ ƒ™Üēc$¤Æ£Æ¢ÆÓ„$|'ē$! ų  $ ¼¼€™ ų PdŽ!Č ų ! ` ¼0€™čč9' ų ! ` ¼¼€™ ų ! ` ¼€aŽ@ €„ü„™č„$!(Ą ų !0  ¼a®dæ`¾\·X¶TµP“L³H²D±@°$ąh½'<`ģœ'!ą™°’½'LæÆH¾ÆD·Æ@¶Æ<µÆ8“Æ4³Æ0²Æ,±Æ(°Æ¼Æ€—„™4bõ&!š !ČĄ ų ¼€„$€™HH9' ų $ ų $ ܏Ā™ ų ! `° ܏.$ ˆ! `Xŏ¹’!0 Ā™ ų  ܏! €¬ƒ™!( ų !0 ܏! €ą‚™8Å' ų *$*$ C ܏ €‚ €… €‡ ƒ™īB$Ó„$ų&ē$I$¢ÆT·Æ8ď’<$.’‚0%e%b&ai<%dyxB4 bQċ €‚ €… €‡ ƒ™,īB$Ó„$ų&ē$N$¢Æ:·ÆųĒNě֒ę$$.’ƒ0%E%C&%D FMĀ“ €‚ €… €‡ ƒ™PīB$Ó„$ų&ē$S$¢Æ!·Æ@>ƒŖ@! €‚ €… €‡ ƒ™xīB$Ó„$ų&ē$X$¢Æ·Æ ų  ܏ø„™ ų DŒ ܏¢Æ €‚ €… €‡ØīB$ ƒ™¢ÆÓ„$ų&ē$^$ ų $5 Üą™dŃ' ų ! CŠ ܏CšČ™$0p.’b02%0Å%0Ā%0Ć!  ų *E& ܏(Š'Œƒ™!(  ų !  ܏! ؂™E& ų $@ ܏ €‚ €‡ €… ƒ™¼īB$Ó„$$¢Æ·Æų&ē$ ų f$ ܏ųŏ „™ ų ! @ ܏! €Ā™ ų  ܏\’’$€‚ü™`bPŒ!Ø S&Ž!Č  ų $&@ ܏ Ž-@"’C’$’E’%D%e*C"@ „™ųŏ ų ! @ ܏Ā™ ų ! € ܏Žį’!(` €‚ €†„™ų&B$¢ÆÓĘ$$$ ų |$!€@@ ܏'!€‚’’$®`bCŒ®`bP¬Ž€ „™ ų Ž ܏ހ™ ų  ܏®®ųĀ!® ®˜ƒ™!(ą“Æ Æ$ ų $!@’’$m’B ܏V’X™!襄揀¾|·x¶tµp“l³h²d±`°!`ąˆ½'<ğœ'!ą™°ż½'LæÆH¾ÆD·Æ@¶Æ<µÆ8“Æ4³Æ0²Æ,±Æ(°Æ ¼Æ$€™!€€€„HH9' ų db„$ ¼€‚`bCŒ b¬cŒż’`$Z „™ €†Ø„™“ƒ‡(±'ąīĘ$$ ų !  ¼‚™ ų ! !€@@ ¼2X™ C€.$b!Č@ ų ±Æ!ČĄ ų !  @ ¼ģƒ!( bŒB(@šīÄ'!Ȁ ų   ¼ü„™0€‚!  ȃ™ €ž!˜ ؄™!ø ! Ø3V$(µ'!Č` ų !  ¼ Q$ €ƒ!8ąųęf$!  Õ’@$š€™ ų !  ¼ ų  ¼ø„™ ų DŒ ¼¢Æ €ƒ €… ļc$ €‡£Æ ƒ™(£'£ÆÓ„$č&ē$$ ų ē$ ¼ „™€‚!Ø Ā™`bPŒ!  ¼€™!°@!˜ &! Ž@Ž ! @Q®`bŃ®Ž`! `bˆ!Č b˜*6’C0’„0%(¦%(£%(¢ ų *„$ ¼!Ȁ ų Ž ¼!Č` ų !  ¼!€ Ś’€„$€™U9' ų db„$ ¼LæH¾D·@¶<µ8“4³0²,±(°ąP½'<ܜœ'!ą™Š’½',æÆ(“Æ$³Æ ²Æ±Æ°Æ¼Æ€“’’$`EbŽ$T$€‚€‘€HHR$!Č@ ų 9'  ½'¤' ų ¢Æ¼!0@ €…t„™! @ ų š„$¼Ģ&Ž €…t„™! @ ų š„$ų"Ž@¼ €‚ŠļF$ €‚ŌļF$ €…t„™! @ ų 0š„$”$Ž€¼ €‚lęF$L™ ų ¼!0@’'– €…’ā0t„™:%8GHš„$ ų ! @¼ø$ŽL™ ų >°'¼¶'– €…’ć0t„™:%8g!0@hš„$ ų ! @¼&Ž €…t„™! @ ų ˆš„$¼! @ €…t„™ ų  š„$¼Ō&ŽČ„™!  ų ’$¼!0 €…t„™! @ ų `į„$¼! @ €…t„™ ų “š„$¼!€t„™ €ž!Ø Ё™ €—!  $‚™L3&!° ! `!Ȁ ų !(! @@¼& €…!ČĄ ų ¼! @!0@!Č  ų L Å'$¼& ! `!Ȁ ų @¼! @!Č  ų Ģńå&¼& $! `Ś’!Ȁt„™Čš„$ ų ! @¼ €…t„™@ķ„$ ų ! @¼! @ €…t„™ ų Šš„$¼ °'$€™! !(ŒD9' ų $¼!0 €…t„™! @ ų `į„$ō"޼č&Ž@ģ'Ž €‚äšB$ €‚čšB$ €…t„™¢Æ! @ ų ģš„$¼! @ €…t„™ ų x„$¼$€™Šx9' ų !  ¼ €… ŽDń„$ ų ! @¼! @ €…t„™ ų x„$¼!dæ`¾\·X¶TµP“L³H²D±@°ąh½'<’œ'!ą™ ū½'\æÆX¾ÆT·ÆP¶ÆLµÆH“ÆD³Æ@²Æ<±Æ8°Æ ¼ÆT‚™(°'!(!؀ ų !  ¼€„$€™HH9' ų ųE„$ ¼!   €‚ €…”ńB$¢Æ €‚ €†œńB$¢Æ €‚ €‡¤ńB$t„™¢Æ€‚Xń„$|ńĘ$Œńē$ ų |bQŒ ¼0°Æt„™0°'!° ™! ˆ‚™!˜ Ȁ™!𠁙±!ø Ø"Ž0 £°#Ž(¤c0 `# D!Č@ ų !  ¼’$#0Ā €‚! !Č` ų ¬ńE$ ¼°"ŽB0 @!Č@ ų !  ¼’$#0Ā €‚! !Č` ų “ńE$ ¼°"ŽB0 @!Č@ ų !  ¼’$#0Ā €‚! !Č` ų ÄńE$ ¼°"ŽB0 @!Č@ ų !  ¼’$#0Ā €‚! !Č` ų ŠńE$ ¼°"ŽB0 @!Č@ ų !  ¼’$#0Ā €‚! !Č` ų ÜńE$ ¼°"Ž B0 @!Č@ ų !  ¼’$#0Ā €‚! !Č` ų čńE$ ¼°"Ž€B0 @!Č@ ų !  ¼’$#0Ā €‚! !Č` ų ųńE$ ¼°"Ž@B0@0¢ƒ!Č@ ų !  ¼’$#0Ā €‚! !Č` ų ņE$ ¼0¢ƒ5@!Č@ €‚! ņE$!ČĄ ų $ ¼! !Čą ų @$C$!0  ¼ 0b! !8!(ø‚Œ£$B( (bē$$ł’ā„$€P'& €‚„Æ!  ņE$“Æ °Æ €‚ €ƒ\ņB$„ƢưÆ!  8ņe$!ČĄ ų  ¼ø1ŽO’ €„$€™ ų ! 0£ ¼!bĶ’@ U9' ų ųE„$ ¼\æX¾T·P¶LµH“D³@²<±8°!ą`½'<Ųœ'!ą™Øū½'L¾Æ!š PæÆH“ÆD³Æ@²Æ<±Æ8°Æ¼ÆŒw’$$C¬€‚0€™FBŒ!  ¬$Ą¬Č9'¢¤$!˜Ą ų !ˆ€!€@(@܏ƒ™`®!  ų  Å'@܏BŒ€„BŒĄ„™Cˆa„$C˜Ł$‚¦ƒ®\e& $ ų $܏“!ˆ €‚ €… €‡ ƒ™hņB$±Æ¢ÆÓ„$ģ"ē$$ ų j $܏„’’$$b®”Ž@øށ@’’$äŽ@ąŽ*Cz@’’$y`$€™dŽo’"$ ų $ ܏! „™ ų !ˆ  ܏,Āx"®$™ ų x$Ž ܏€"®|"®!čĄ! <æ8¾4µ0“,³(²$± °ą@½'<8sœ'!ą™ąō½' æÆ µÆ “Æ ³Æ ²Æ ±Æ °Æ ¼ÆÄƒ“H‚™<“'!€€!Ø !Ą! €!(¼$ ų !ˆąbŽ@ ¼ €‚ €… €‡ ƒ™õB$¢Æ²Æ±ÆÓ„$%ē$! ų +!$ ¼Ü„™0 §ų¤'(„' ų !0 @ ¼bŽ|@ æ €‚ €… €‡(õB$ ƒ™¢Æ±ÆÓ„$%ē$! ų /!$ ¼l! 0€™ ŽŽŽŽ,¢Æ0£Æ4¤Æ8„ÆPµÆ! @!0€ˆM9' ų ,„'X@ ¼H‚™ü³'!($ ų ! ` ¼ų§l„™! `$ ų ų¦' ¼P¢0€™! !(,¦'$“9' ų ¢Æ!€@>@ ¼Ą@#b(€‚$€™€bB$!bHH9' ų ! @ ¼€€‚€bB$!ˆb%Ž& $€™Ą„Œ P‚™€‚ ų paDŒ ¼€‚0€†0€™paDŒ!8x÷Ę$0Ž\æ9' ų ˜:$ ¼Ą®#Ž$€™ŒbŒ$B4Œb¬ü ¢$Ž¢Æ’’$#$!8³Æšd9' ų ¢Æ ¼$€™U9' ų ! @ ¼$’’$ æ µ “ ³ ² ± °ą ½'<`pœ'!ą™Š’½',æÆ(²Æ$±Æ °Æ¼Æ¢(!€8@!€Ą$¢ €…!ˆŠ‚™Č ų Tõ„$-@¼$0€™Ž Ž! ’’$(h9' ų ±ÆA¼ €…Žt„™! @\õ„$ @ Ž €…t„™! @€õ„$!0ą ų ¼! Ž €‚°õB$ €‚„äB$ €…t„™¢Æ! @ ų ¼õ„$š’¼$,æ(²$± °ą0½'<4oœ'!ą™h’½'”æÆ“ƌ³Æˆ²Æ„±Æ€°Æ ¼Æ!ˆĄ €†Ø„™,°'äõĘ$!˜€!  ! P$!ą ų !8  ¼(¤'؃™!( ų $!@ ¼Äƒ‚BŒ@(¢ €‚ €…ģõB$ €‡¢Æ(¢ ƒ™±Æ¢Æ²ÆÓ„$ü$ē$! ų Ą$ ¼(¢ R0€™$! `!(€!8!0(h9' ų ¢Æ ¼”提“Œ³ˆ²„±€°!ą˜½'<nœ'!ą™Ąų½'4¾Æ!š 8æÆ0¶Æ,µÆ(“Æ$³Æ ²Æ±Æ°Æ ¼ÆÄ‚Œ!؀B,! @”Œ €‚ €… €‡ƒŒ ƒ™,öB$Ó„$Ü'ē$$ $¢Æ@£ÆH‚™XÓ'! `!( ų ¼$ ܏8Ń'€‚H‚™ģ`BŒ!( $!  ų dĀÆ ܏™ ų ! @C$Ā ܏Ą#č£P„™ °'F$!(@ ų !  ܏! $€™Ly9' ų !( LĀ@ ܏ €‚čõB$LĀÆ0€™Dď!0`ˆM9' ų (Å'@ ܏ €‚ €…PöB$¢Æ €‡DĀ ƒ™¢ÆÓ„$Ü'ē$$/ $ ų  ܏p’’$8Ā@<ĀtƒG@tĀ'<Ā@@ĀÄƒC@ÄĀ'@Ā@PĀƒ?@Ā'PĀ@Ȁ™$ƒ;@$Ā'Ȁ™€³&! `ŌÅ' ų P$Hď € ܏D™ ų ’’B0’C0%b ܏*ƧH‚™Š'!($! вŽ ų Ō±Ž ܏!  …™ $ ų $ ܏LĘš™!  ų $Tď € ܏™ ų a$@ ܏¤‚™!  ų $ Üš™Š'! -$ ų “Ę' @ Üš™!0@!  ų $ Üą¦’0„™!  0„™ą¦’! &$! &$C$ ų Š' ܏0„™č¦’'$ ų !  Üģ¦– …™!  ų ($  Üš™!0 !  ų $ ܏€‚’’”2€bB$€!bbŒŒBŒ€B0@Ų¦ŽĄš™!  ų $ ܏ ¦ŽĄĀ€Į@š™Ģ¦ŽĄĀ€Ą@š™Ü¦ŽĄĀ€æ@š™PʏĄš™Ä' ų $ ܏8ʏĄš™Ä' ų $ ܏dʏĄĄ …™’’Ę0Ä' ų +$ ܏Ą@#b(€‚$€™€bB$!°bHH9' ų ! Ą€¢&'@ ܏€¢‚$@€ƒ›€š‚‚B® @™™ ų ! +Q@ ܏…™! ™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ ų !(` ܏8ӏ0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@ PŽš‚‚" B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @ B®€‚€€bB$!bbŒ…™ DŒ8ŏ ų  ܏€‚€€bB$!bdŒdĀ™`‚¬dŒpĀtÓ'‚¬rŒ ų ! `!ˆ@ ܏@DPŽš‚‚"DB®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @DB®€‚€€bB$!bbŒ…™DDŒtÅ' ų  ܏€ƒ€€bc$!C™ÄÓ'RŒ ų ! `!ˆ@ ܏@HPŽš‚‚"HB®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @HB®€‚€€bB$!bbŒ…™HDŒÄÅ' ų  ܏@ӏ0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@0PŽš‚‚"0B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @0B®€‚€€bB$!bbŒ…™0DŒ@ŏ ų  ܏<ӏ0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@$PŽš‚‚"$B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @$B®€‚€€bB$!bbŒ…™$DŒ<ŏ ų  ܏ „™Š'x¦Ž!  ų  $ ܏€€‚ „™€bB$!ˆb"Ž$FŒ ų !  ܏$¦– …™ $ ų !  ܏0€™|·9' ų dÄ' ܏!  „™!0@ ų $$Ž,ƒŒ ` ܏Ā!CC(‚¬0Ž€‚,Ž paDŒ€‚aEŒ Ā!EC(‚¬€‚0ŽpaDŒ0€†0€™@(»Ę$\æ9' ų !8€ ܏Ģ®€‚€€bB$!bdŒlĀ$€™‚¬Ā'dŒ¢ÆĀ$¢Æ’’$$!8šd9' ų ¢Æ ܏$€™U9' ų ! Ą ܏!  ø™ ų $ ܏$!¹ż8ĀÆ½ż<ĀÆĮż@ĀÆÅżPĀÆÄ' ų  $<ž ܏Ä' ų  $=ž ܏Ä' ų $>ž ܏€bc$!C™RŒ ų ! `!ˆ@ ܏]ž@PŽ^ž‚!čĄ8æ4¾0¶,µ(“$³ ²±°ą@½'<bœ'!ą™’½'üæÆų¾Æō·Æš¶ÆģµÆč“Æä³Æą²ÆÜ±ÆŲ°Æ ¼Æ$¤Æ¢!€Ą$«¢$ €…!Š‚™ Č ų ę„$—@ ¼X‚™Ž@¤' ų  $@ ¼$ €‚ €‡øöB$¢Æ €‚ €…ĄöB$¢Æ €‚ €†ĢöB$¢Æ €‚t„™ŠöB$¤°öē$¢Ætö„$ ų tįĘ$ ¼Ą¤'€‚˜™\bEŒ ų !0Ą¢ ¼(¢ÆÄ¢h„™,¢ÆČ¢(¤'0¢ÆĢ¢4¢ÆŠ¢8¢ÆŌ¢ ų <¢Æ ¼!€@ €‚t„™dį^$ €‚!˜ ÷W$ €‚Č€™ōöV$ €‚!ˆ čöU$$€‚I˜xT$ @‚™Ž Æ@¤'!0 ų !86@ ¼Ž ¢€ @`¤'Žą €‚ā€>@ €‚`¤'ÜöE$!Č  ų Z$HŽ<$b@ ¼!( €b0@@b0!(Ą!(ą (Ā€‡œŽ4Fē$ €ˆ €™˜Ž āŽ8ŽŌļ9'Šļ%¢Æ €‚ @$¤„Æ£ÆØÆ÷E$!Č` ų `§'!Ȁ ų !  ¼h„™ ų (¤' ¼!€@·’@ ™ ų @¤' ¼ ! $ €‚Ø„™`¤'Z$ ų D÷F$Ā’HŽüæų¾ō·š¶ģµč“ä³ą²Ü±Ų°ą½'<`_œ'!ą™Ą’½'8æÆ4±Æ0°Æ¼Æ€‚!ˆ€“@C$fŒ“@BŒcŒ!   €…™(¦Æ ¢Æ$£Æ ų T÷„$!0@ @¼B€@0€™ €…0™h÷„$ ų ! ¼0€™ ¢'!0 ’’$$$ā9' ų ¢Æ¼!€@ €…0™!  ų `÷„$!¼8æ4±0°ą@½'<|^œ'!ą™’½'쿯辯䷯දܵÆŲ“ÆŌ³ÆŠ²ÆĢ±ÆČ°Æ8¼Æ$¢𤯖$ €‚ €…tįB$¢Æ €‚ €†Ų÷B$¢Æ €‚ €‡ä÷B$¢Æ €‚t„™š÷B$¢Æ €‚x÷„$ō÷B$ ¢Æ €‚Č÷Ę$ü÷B$$¢Æ €‚Š÷ē$ųB$ ų (¢Æ8¼¬ Æˆƒ™(€‚Ą¹ÆL™€bV$°¹Æ$‚™€‚“¹Æt„™€bW$@¢'ø¹Æ¼¢Æ$€™HH9' ų ! ĄćŽH`8¼ŒbŒ B0@’’$¤¢Æ   ÆądŒĄ¹ ų ¼„h¢p£¤¢Æl¢8¼#b £ÆāŽšFŒųCŒĄØ£Æ €•åµ&Ռ°¹ ų 4DŒćŽ8¼ tŒ€!š@‚‚@ €”å”&dŒ“¹Ąp”Āq”ür ų žs0¢Æ8¼Ø¢ ¹$¢Æ¤£ €‚,¹Æš¤ø¹ ųE$“Æ°Æ±Æ²Æ ³Æ(£Æ!0  ų !8Ą¬¢8¼B$¬¢Æ$€™U9' ų ! Ą8¼Ö&€‚@EBŒ©’Ā÷&¬£$b €‚čõG$ €‚„äG$ €…t„™š¤¬¦ ų čå„$8¼!ģæč¾ä·ą¶ÜµŲ“Ō³Š²Ģ±Č°ąš½'<Ø[œ'!ą™ął½'¾Æ!𠿯·Æ¶Æ µÆ“ƳƲÆü±Æų°Æ¼Æ €H‚™,’! €’$ŁÄ'ŲĀ£!Ø  ų !(܏,’H‚™ŁÄ'!(’$ ų ŲĀ£܏,’H‚™ŁÄ'!(’$ ų ŲĀ£܏4Ń'H‚™! !(¤$ ų  Ž܏4ŠÆ€‚€‚™\bDŒ!(  ų $!@;@܏Œ‚Ž<$C @(„™TD& ų ’’$ŒƒŽ’ž<’’B4$b܏Œƒ®Sށ™ ų ! `!ˆ@܏@8Žš‚‚8‚®‚ @™™ ų ! +Q@܏…™!  !(`™%&L„&†& ų $܏@8‚®…™EŽ! @ ų ܏$€™˜x9' ų ! @܏ō‚ŽB0Ś@’’$$„Ž Ȁ™ŲÄ' ų $܏T„Ž Ȁ™ŲÄ' ų $܏X„Ž Ȁ™ŲÄ' ų $܏\‚ŽB00@Ųƒ.@¢,‚ŽB€)@Ȁ™”ŲŠ'ō‚YŒ ų ! @܏ @!0Ąœ„ƒyŒ ų (…Ž@܏Ø! €™ €‚Ó%'°Æ·Æ$„$!Č` ų H$G$܏! !Č  ų äÖE&܏!€@! Ż’$’’’$\ƒŽb0g@b0$Ž™ ų ! C$Ā܏Ą#č£P„™±'!(F$ ų ! ܏ Ā'Š‚™ŲĀÆōٯ́™$Ć'ÜŁÆą™ŲĀ'ąŁÆ™ŲÓ'!° ȁ™äĆÆ!Ø Œƒ™šĀÆčٯ䁙 ŃÆ!ø ŲŁ'4ģŁÆąŁ ų ! `(Ž܏!ČĄ ų ! ܏!(!0@!Č  ų ! `܏!ČĄ ų ! ܏! `!( !Č  ų !0@܏äď裏 ų !(`܏!äƏģŁ!r €…@ F! $!Čą ų XŻ„$R&$ó’B܏ģďōŁ ų šŏ@܏ €…ŲďÜŁ ų ųŻ„$!ˆ@Ę’@܏(’’$&@’’$ü™$…Ž ų ŲÄ'@܏’’$!^’@ˆ’\ƒŽ,…Ž! $ ų  ĄÆ܏ Ń' €’Ģ™ ŠÆ!  ų äÖE&܏!€@́™ €‚!Ø  ƒ™lųW$!˜ k’ŲÖ'!čĄæ¾·¶ µ“³²ü±ų°ą ½'<$Vœ'!ą™€ū½'x¾Æ!š |æÆt·Æp¶ÆlµÆh“Æd³Æ`²Æ\±ÆX°Æ ¼ÆH‚™„ÅÆ!ˆ€!ØĄ@Ä'!($!øą ų Ą4– ³Ž'` ܏™ ų ! `!@ ܏@ 0Žš‚‚ "®‚ @™™ ų ! +R@ ܏…™!  !(`™E&L$&&& ų $ ܏@ "®…™ „Ž! @ ų  ܏P³Ž&`™ ų ! `!@ ܏@(0Žš‚‚("®‚ @™™ ų ! +R@ ܏…™!  !(`™E&L$&&& ų $ ܏@("®…™P„Ž! @ ų  ܏H§Žąā0 !°@!°ą$€™L„ŽčB9' ų !  ܏` ®ąĀā‚@„ŁĀ@B€@„Ł€‚˜™XbEŒ(Š'!  ų !0 ܏@Ā'ü™d#&! h„™’’$d7&LŁÆHŠÆPĀÆATĆÆ($޹Æ0€™d#&d(&@Ā'ʏ!(ą!8Ą¢Æ£ÆT 9' ų ØÆ ܏m!˜@$Ž€‚€~@!Č@Ž€‚€~@!Č@”Ž€„ŏØŽ£Œ$ D$CD$€™PŁ($ŽŽŽ„Ā¹ÆTƏ0€™!8Ą¢Æ£ÆT 9' ų ·Æ!˜@@ ܏$€™! 2Šx9'$€™Šx9' ų !  ܏LŁ ų Hď!€@Ģ’@ ܏Y0Ž$€™HH9' ų !  ܏€€‚€bB$!bqŒ$€‚ ŠxP$!Č ų ! @" ܏@Ā'($ŽEŽFŽ0€™¢Æ„Ād#&d(&T 9'!8Ą¢Æ£Æ ų ØÆ!˜@! @!Č ų  ܏HH9' ų !  ܏€€‚€bB$!bqŒ H’’$L¢Ž@Œ"Ž0B4Œ"®@`@Ā'¢Æ@Ā$€™¢Æ’’$! $ $!8šd9' ų ¢Æ ܏1!˜@ ų Ž€’@ ܏£’$€™ ų  %Ž€’@ ܏’$€™™ ų ! C$Ā ܏Ą#č£P„™ ±'!(F$ ų !  ܏Ą@#b(€‚$€™€bB$!€bU9' ų !  ܏! 0€™“9' ų !(!@‡’@ ܏­’$€™!čĄ!`|æx¾t·p¶lµh“d³`²\±X°ą€½'9' ų &’(¼€„Dƒ™ ų X„$ @(¼ €‚ €… €‡ ƒ™č’B$¢ÆÓ„$'ē$$ ų ‰*$(¼€–„™ €‚!š !ø!ØÓT$Z˜EÓ& €ƒ!ČĄ,'c$ ų £Æ!€@(¼”D$O@!ˆ@$€™$÷&`M9'® ų l®(¼!(0€™pš9' ų ¬&(¼“„™ ų ! @(¼! @܀™ ų $(¼¹"$ €ƒ¢Æ €‚,€†,ƒ™'B$DÜc$!(@DvĘ$ Æ“Æ¢Æ £Æ!8 ų h&@(¼ €‚ €‡ ƒ™B$¢Æ!(€ŗ"$,'ē$ ų $(¼! ¼€™ ų !ˆ(¼€„$€™HH9' ų  E„$˜EĀŽ@(¼q®˜EŃ®bŽQ¬q®€„$€™U9' ų  E„$(¼µ&€ƒ0²'GbŒ!0€*¢±"$Ü$Ÿ’@$Ć"$ €™ €¢Æ €‚€„0€†Ó2''&,ƒ™Ą4(B$”E„$čńĘ$!(!8 ¢Æ±Æ²Æ ų °Æ(¼Ä"$¢Æ €‚€„0€†ģ“,ƒ™8B$±Æ²Æ°Æ ¢Æ`E„$ļĘ$!( ų !8bŽB(@(¼ €„ü„™H„$ ų !(ą(¼bŽB(@ü„™ €„ ų l„$(¼€„$€™HH9' ų G„$(¼€‚ųFPŒ0€‚t'Q$!Č  ų (¼(Žś’! €„$€™U9'€ ų G„$(¼XbŽ$€†øƒ™@CĘ$!( ų !8(¼XbŽ0€†øƒ™ĢĘ$!( ų !8(¼0€™œ;9' ų ! (¼`ƒ™ ų (¼!|æx¾t·p¶lµh“d³`²\±X°ą€½'<Šœ'!ą™˜’½'`æÆ\µÆX“ÆT³ÆP²ÆL±ÆH°Æ¼Æ €„,€™“’„$ܟ9' ų $@¼€‚˜™XbEŒ0¤' ų !0¼“'$€‚h„™ģ~S$$€‚!ˆ ŠxR$0¢¢Æ4¢¢Æ8¢ ¢Æ<¢$¢Æ@¢(¢ÆD¢ ,¢Æ°ŽB0@!Č@!Č` ų ! !Č@ ų ! ¼!Č  ų ! €!€@š’@¼€˜™\bŽ0¤' ų !0¼!؀$€‚ą€™˜xS$0¢! ¢Æ4¢h„™¢Æ8¢!ˆ  ¢Æ<¢! $¢Æ@¢(¢ÆD¢ ,¢ÆHŽB0@!Č`\b„Ž!Č@ ų !(!Č` ų ! ¼!Č  ų !  !€@ļ’@¼€„$€™HH9' ų G„$¼€‚ųFPŒ0€‚t'Q$!Č  ų ¼(Žś’! €„$€™U9' ų G„$¼0¤'€‚˜™XbEŒ ų !0¼²'0€‚h„™xT$$€‚!ˆ ŠxS$0¢¢Æ4¢¢Æ8¢ ¢Æ<¢$¢Æ@¢(¢ÆD¢,¢Æ!Ȁ ų !Č` ų ! ¼!Č  ų ! @!€@¼! @ņ’@!(0€™œ;9' ų ! ¼`ƒ™ ų ¼`æ\µX“T³P²L±H°!ąh½'<Äœ'!ą™,€™Ā9' <Øœ'!ą™,€™Ā9' <Œœ'!ą™Ų’½'$æÆ ²Æ±Æ°Æ¼Æ$!€¢!ˆĄJ$ €… Ќü™Œ„$ ų !  @¼,€™Ā9' ų ¼! @ €…t„™ ų „$5¼0€™! Č9' ų !(!€@&@¼°CŒ<$b@$€™<%b! y9' ų °®¼0€™č¾9' ų ! @¼ &Ž €…t„™! @Ø„$ €… &Žt„™! @Š„$ ų ¼$€™Šx9' ų ! ¼ €… &Žt„™! @ ų „$¼!$æ ²±°ą(½'<œ'!ą™’½'ų¾Æ!š üæÆō·Æš¶ÆģµÆč“Æä³Æą²ÆÜ±ÆŲ°Æ ¼Æ€‚€€bB$!brŒ!؀ÅÆ@! Ą|’’$ӌ+`™ ų ! `!ˆ@ ܏@PŽš‚‚"B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ…Ž ų  ܏„Ž5€ģƒ™ ų  ܏“Ž€‚€€bB$!b™rŒ ų ! `!ˆ@ ܏@PŽš‚‚"B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ…Ž ų  ܏ “Ž0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@ PŽš‚‚" B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @ B®€‚€€bB$!bbŒ…™ DŒ …Ž ų  ܏“Ž0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@PŽš‚‚"B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ…Ž ų  ܏@“Ž0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@PŽš‚‚"B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ@…Ž ų  ܏D“Ž0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@PŽš‚‚"B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒD…Ž ų  ܏“Ž0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@PŽš‚‚"B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ…Ž ų  ܏4“Ž0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@4PŽš‚‚"4B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @4B®€‚€€bB$!bbŒ…™4DŒ4…Ž ų  ܏ “Ž0`€ƒ€€bc$!C™RŒ ų ! `!ˆ@ ܏@ PŽš‚‚" B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @ B®€‚€€bB$!bbŒ…™ DŒ …Ž ų  ܏„Ž€€ƒ€€bc$!CBŒŠD¬„Ž€€ƒ€€bc$!CBŒŌD¬„Ž€€ƒ€€bc$!CBŒŲD¬,„Ž€€ƒ€€bc$!CBŒČD¬<„–€€ƒ€€bc$!CBŒ°D¬(„Ž€€ƒ!€€bc$!CBŒ$ĢD¬8‘Ž0…Ž$  ˆQ€‚€€€bB$!€ŽĄ„™€„$ $ ų !8 ܏ŽĄ„™0…Ž@„$ $ ų !8 ܏ @"*€‚€€bB$!bcŒČbŒĢb¬"*@€‚ĀL™DŒ ų ’’$ ܏¢Æ €ƒ €… €‡ ƒ™0c$£Æ±ÆÓ„$Ä#ē$$ ų e$N ܏˜™\bEŒØÄ' ų !0 ܏€€‚ü™€bB$!˜b$€‚ŠŁÆ˜xT$<Ā'ÄĀÆØĀh„™<ĀÆ¬ĀČŁÆ@ĀÆ°Ā|ƒ™DĀÆ“Ā!ˆHĀÆøĀ!LĀÆ¼ĀĢŁÆcPĀÆbŽ DŒ€‚€±@ŠŁ˜ŽĢŁ ų ŏQ@ ܏bŽEŒ ¢€Ŗ@$€™bŽ BŒ@B€Ŗ@Ž @ Ž˜x9' ų !  ܏G!ˆB€@Ž@B€@˜Ž @+Ą!Ȁ  ų !  ܏!ˆ'$!ą!Ȁ  ų !  ܏!ˆ$˜Ž @ĄĀ@!Ȁ  ų !  ܏!ˆ$ @!Ȁ  ų !  ܏!ˆ$!Ȁ ų !  ܏B*ĄĀÆW*V*ČŁ ų Äď!€@•’@ ÜĪ !  €ƒ€€bc$!CBŒ TŒń€’’$‚‚ī@ €‚N €’ĀL™ ų DŒ ܏¢Æ €‚8ƒ™hD&PŚÅ&!0€ ų “ŁG$!ˆ@L@ ܏Ł2  €†'—’ā0؄™,Š':%8GHŽĘ$$ ų !  ܏ĀL™ €— ų DŒ ܏¢Æ €ƒ8ƒ™tśs$³Æ°Æ ÆhD&PŚÅ&!0€ ų “Žē&!ˆ@(@ ܏ĀL™ ų DŒ ܏°Æ8ƒ™ Æ“Žå&!0@!8` ų hD&!ˆ@@ ܏8ƒ™hD&PŚÅ&!0€ ų !8!ˆ@ž@ ÜŠ‚™ €‚! “ŁS$!€ Ž!Č@ ų !(`@ ܏,ĄÆ(ĄÆŽŠ„™,Š'!( ų (Ę' @ ܏ĀØ‚™! E$ ų $ņ@ ܏p™ ų ! | ܏ŽėŠ‚™ą’Ž!Č` ų Ž@ ܏Žøéå&!Č` ų ! @@ ܏! @!Č` ų ’Å&e@ ܏Ž €‚ė’°éE$€,€™Ų`Ž! €B<ē8ē0!( Ȍ9' ų !0 ܏! @p™ ų ! O€ ܏Ų`Ž<$D @HƒŽ%dH‚®€‚ ƒ™\bDŒ!(€ ų !0 ܏b4H‚®€ƒ€€bc$!CBŒEŒ  €‚¢€ @€‚Ø$€™˜x9' ų ! €! @+@ ܏€‚4„™€€bB$ Ž!  !ˆbŽ ų Ž!@@ ܏"ŽäBŒb¬"ŽäC¬Žó’!Č@P‚Ž @€‚€€bB$!bdŒ<Œ‚Œ%CŒ‚¬€ƒ€€bc$!CBŒX†&@G$˜ˆ&ŒÌČ ŌĘ$ā¬ć¬ä¬ å¬ö’Čē$€‚€(€bB$!(¢¤Œ’æ$Œ‚Œ$CŒ‚¬¤ŒH‚ŽŒƒŒ@B0%bŒƒ¬¤Œ’’<ŒƒŒ’B4$bŒƒ¬¤ŒH‚ŽŒƒŒ€B0%bŒƒ¬¤Œž’<ŒƒŒ’’B4$bŒƒ¬¦ŒH‚ŽŒÌ<$D%bŒƬ£Œ<‚Ž`b¬²Œ QŽ "‚-@€‚“ށ™ ų ! `!€@@ Üš‚‚" B®"‚ @™™ ų ! +P@ ܏…™! !(`™&LD&F& ų $ ܏ @ B®€‚€€bB$!bbŒ…™ DŒ…Ž ų  ܏€‚€ €bB$! ‚…Œ÷’$Œ¢Œ$CŒ¢¬…ŒH‚ŽŒ£ŒB0%bŒ£¬ƒŒL‚Žb¬’ŒPŽ‚T@€ƒœ“Ž%`™ ų ! `!ˆ@&@ ܏‚ @™™ ų ! +Q@ ܏…™! ;!(`™%&LD&F& ų $ ܏5@B®€‚€€bB$!bbŒ…™DŒ)œ…Ž€“ ų 4Fd&!ˆ@@ Üš‚‚#B®‚ @™™ ų ! +Q@ ܏…™! 4Fe&™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ€…DŒ…™4F„$ ų  ܏€ƒ“Ž€bc$€!C™RŒ ų ! `!ˆ@ ܏@,PŽš‚‚",B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @,B®€‚€€bB$!bbŒ…™,DŒ…Ž ų  ܏€‚€€bB$!bdŒ8‚Ž\‚¬dŒD‚ސ‚¬dŒ‚Œ@B€ @ ‚Œ@B€@C$¦Ų‚¬H‚ŽB0m@€‚€€bB$Ō€¬!bbŒ™Š@¬ “ŽrŒ ų ! `!ˆ@ ܏@PŽš‚‚"B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ …Ž ų  ܏€ƒ$“Ž€bc$€!C™RŒ ų ! `!ˆ@ ܏@ PŽš‚‚" B®‚ @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @ B®€‚€€bB$!bbŒ…™ DŒ$…Ž ų  ܏€‚€€bB$!bcŒ$Ųb¬€‚€€bB$!brŒQŽ "‚,@ “ށ™ ų ! `!€@@ Üš‚‚"B®"‚ @™™ ų ! +P@ ܏…™! !(`™&LD&F& ų $ ܏ @B®€‚€€bB$!bbŒ…™DŒ …Ž ų  ܏ “Ž)`b‚&@€ƒµ€š‚‚!@B® @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @@B®€‚€€bB$!bbŒ…™@DŒ …Ž ų  ܏“Ž)`b‚&@€ƒ–€š‚‚!DB® @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @DB®€‚€€bB$!bbŒ…™DDŒ…Ž ų  ܏“Ž)`b‚&@€ƒw€š‚‚!HB® @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @HB®€‚€€bB$!bbŒ…™HDŒ…Ž ų  ܏@„Ž€€ƒ€€bc$!CBŒÜD¬“Ž*`€‚b‚'@€‚P€ƒš‚‚!4B® @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @4B®€‚€€bB$!bbŒ…™4DŒ…Ž ų  ܏€‚€€bB$!bDŽo’<ŒƒŒĻ’B4$bŒƒ¬EŽHƒŽ<Œ¤Œ0B4$b% ƒŒ¤¬Ž‚"@™“ށ™RŽ ų ! `!ˆ@ ܏@@$PŽA‚E$  @ ü€™TÓ'! !0` ų P$@ ܏ €‚ €…|ņB$¢Æ‚Ž €‡ ƒ™¢ÆÓ„$Ä#ē$$ ų ó$G ܏™RŽ ų ! `!ˆ@ ܏@$PŽ‚@™™ ų ! +Q@ ܏™%&LD&F& ų $ ܏-@$B®€‚€€bB$!bbŒ…™$DŒ!TÅ'š‚‚!$B® @™™ ų ! +Q@ ܏…™! !(`™%&LD&F& ų $ ܏ @$B®€‚€€bB$!bbŒ…™$DŒ…Ž ų  ܏$€™˜x9' ų ! € ܏!°’’$Ā˜™ FŒDŒPŒCŒ€‚,ÄÆXbEŒ8ĘÆ4ĆÆ0ŠÆØÄ'!0 ų .Ņ— ܏TÓ'$€‚h„™ŠxT$ØĀ!ˆ TĀÆ¬ĀXĀÆ°Ā\ĀÆ“Ā`ĀÆøĀdĀÆ¼ĀhĀÆ”bŒP!Ȁ’b” R$€™°pŒ! `Šx9' ų 2 ܏€‚ ų  ܏!Č  ų ! `!@ ܏ē’@! @ €‚€‚€€bB$!bcŒŒbŒB4}Œb¬€€bB$!bdŒ÷’$Œ‚Œ$CtŒ‚¬ ų ŽMū@ ܏¢ū!ȀlC9' ų œŽSū@ ܏›ū!Ȁ[ū $€™„ū!ˆ¼ŁB$ €–¢Æ €‚8ƒ™ ÆhD&PŚÅ&!0€ ų “ŁG$!ˆ@¦ū@ ÜŠ‚™ €— €–!˜ 'ü!€ lC9' ų œ„Ž[ü@ ܏Sü$€™€bc$!C™RŒ ų ! `!ˆ@ ܏Cž@@PŽDž‚€bc$!C™RŒ ų ! `!ˆ@ ܏bž@DPŽcž‚€bc$!C™RŒ ų ! `!ˆ@ ܏ž@HPŽ‚ž‚€€bc$!C™RŒ ų ! `!ˆ@ ܏§ž@4PŽØž‚ ų ! C$Ā ܏Ą#č£P„™ ±'!(F$ ų !  ܏! ™ ų /$מ@ ܏įž €‚!čĄ!Ąüæų¾ō·š¶ģµč“ä³ą²Ü±Ų°ą½'„Œ$&(C„$ƒ€@ū’`!E! # £(ą ƒÄbŽ€bc$!CBŒ(BŒg@DƃB€d@8pŽTŁ ų ! €XƏ(܏bŒ!Čą(PŒ! ų ! (܏!(!0@!ČĄ ų ! €(܏!Čą ų ! (܏! €!( !ČĄ ų !0@(܏\ď`Ł ų !(€(܏\ƏdŁ!r €…@ ! $FhŁ ų XŻ„$R&$ó’B(܏dďpŁ ų lŏ @(܏ €…LďPŁ ų ųŻ„$!ˆ@Ä’@(܏&€‚€‚€€bB$!bcŒōbŒB4Qōb¬DŒ ų ’’$(܏¢Æ €‚ €…°B$¢ÆbŽ €‡¢ÆDĀ'¢Æ ƒ™DĀ' ¢ÆÓ„$l$ē$$ ų  $ƒ(܏Dƃ!`ÄbŽ ų DÄ'×’@(܏€‚0FBŒu@¤ƏL™dŒ ų ’’$(܏¢Æ €‚ €…čB$¢ÆbŽ €‡ ƒ™¢ÆÓ„$l$ē$$$ ų `(܏€€‚`€ƒ€‚0FBŒW@ €‚ €… €‡$B$ ƒ™¢ÆÓ„$l$ē$$$ ų J(܏€ƒ€€bc$!C™DŌ'RŒ ų ! €!ˆ@(܏@PŽš‚‚"B®‚ @™™ ų ! +Q@(܏…™! !(€™%&LD&F& ų $(܏ @B®€‚€€bB$!bbŒ…™DŒDÅ' ų (܏Hď €€ƒ€€bc$!CCŒųbŒ*‚@ųd¬ €„d‚™eŽ ų H߄$(܏!€`Ž’’$’’$$€™Šx9' ų ! `‡(܏Ą@#€(€‚$€™€bB$!€U9' ų ! (܏DŅ'0€™! @Č9' ų $(܏!˜@$€™HH9' ų ! ׿`(ÜŲż€‚#ŽōbŒB4,žōb¬B0ēž@D㎾€ƒ˜ž@™ž€‚0ĄÆČ€™DŠ',eŽ!  ų $(܏0Ń' €’Ģ™0ŠÆ!  ų äÖE&(܏!€@ ƒ™€‚!ø ́™€€bB$tŃÆ!° ! b¦žDŃ'0FBŒ²’@ €‚¦ž €…B0,’@€ƒæž€™ ų ! C$Ā(܏Ą#č£P„™(±'! !( ų F$(܏€Š‚™€‚pٯ́™€bB$PŁÆą™!bTŁÆ™XĆÆ!ø ȁ™0Ā'!° Œƒ™4Ć'`ٯ䁙DÄ'hŁÆDŌ'DŁ'LĀÆ\ĆÆdÄÆlŁÆŅž0ŃÆ0FBŒ{’@¤ĀąžL™B0’@ü™ųžeŽ!čĄ!œ揘¾”·¶Œµˆ“„³€²|±x°ą ½'<Ōčœ'!ą™Pū½'ؾÆ!š ¬æÆ¤·Æ ¶ÆœµÆ˜“Ɣ³Æ²ÆŒ±Æˆ°Æ ¼ÆH‚™¼ĒÆ!° !˜€!(€Ä'!øĄ$ ų ĄŌ— ܏€€‚™€bB$!Øb¢ŽPŒ ų ! C$Ā ܏Ą#č£P„™ ±'!(F$ ų !  ܏Ą@#b(€‚$€™€bB$!€bU9' ų !  ܏! 0€™Č9' ų $ ܏!@$€‚@HHY$ ų !  ܏±Æ €‚ €… €‡ ƒ™`ėB$¢ÆÓ„$œ$ē$$ ų L$ ܏Ģ’’$ ų ! ¢Ž@ ܏™’’$€‚<Ų`BŒ$C@<°CŽB4$b`0€‚cŽ`¼P$‚™ ų (Ä'(ʏ! !(`! !(`!0!Č ų  ܏”CŽbŽb@‚‚’C–b–žb@‚‚YŒ DŽ ų $ ܏dŽeŽfŽ cސB&D® C¬E¬F¬L™dŽ ų 0Ń'd– ܏’ƒ0"%d£Æ €†ŠCŽØ„™£ÆLĘ$!8@!  ų P$°BŽB0p@ ܏bŽ;@쁐 €„‚™EŽ8߄$ ų !0 ŽB(!@ ܏€‚€€bB$!bbŒōBŒB0@PŽ €‚XQ$ €‚hQ$L™ ų dŽc– ܏’d0"% ƒ¤Æ €„ü„™x„$!(!0  ų !8@ ܏ €… €†<‚™GŽšŽ„$¤Ę$ ų $ ܏! @0€™¤µ9' ų $- ܏ŽB(@ €†€‚€€bB$!bbŒōBŒB0@EŽ €‚XF$ €‚hF$ €„ü„™ ų Ģ„$ ܏ €† €…<‚™GŽšĘ$šŽ„$ ų $ ܏! @0€™¤µ9' ų !( ܏EŽ €„Ä„™ ų 8߄$ ܏EŽ €„d‚™ ų H߄$ ܏0€™! @x9' ų !(Ą ܏€ƒ€€bc$!CBŒŠ@¼ĀĢEŽ ¤B®€‚P‚™ ų paDŒ@ ܏$€™’’$ĢB®Šx9' ų ! @ ܏€€€‚\aT”`aŽ*t@ €‚ €…B$¢ÆBŽ €‡ ƒ™¢Æ£Æ“ÆÓ„$œ$ē$$ ų ‹$ ܏`aŽ€\aŽ*ƒ@ €‚ €…B$¢ÆBŽ €‡ ƒ™¢Æ£Æ“ÆÓ„$œ$ē$$ ų $ ܏\aŽŠB®ŠT®ŠQŽ! š™bŽ@€‚$€™! @y9' ų paPŒ ܏€Ą)#(£0€†0€™!(±Ą(! '„$č¾Ę$\æ9' ų !8@’’$ ܏CĢB®$€™Šx9' ų ! @ Üš™FŽ€Š'$ ų !  ܏0€™|·9' ų 8DŽ ܏!  „™!0@ ų $bŽ6@ ܏ …™ŠF–$ ų !  ܏! …™$ ų F& DŽ€ ܏‚€@Ų€™a(Å'’$(ĀÆ,ĀB(@,ʏ’$,ĀÆ,ʏ(Ā2%0Ā …™’’Ę0€Ä' ų $ ܏°BŽB0 @š™€Š'0FŽ$ ų !  ܏4FŽš™!  ų $ ܏#ą!€ā‚!@$€™@€„0Ž!Č` ų &@ ܏’’%€C1Žó’ ! ą!€€„$€™U9' ų db„$ ܏ …™!0€Ä' ų "$ ܏!€$€™Šx9' ų ! @' ܏€‚€€bB$!b€Ā'dŒ¢Æ€Ā0€™¢Æ’’$$$!8|õ9' ų ¢Æ ܏!€@ ų ,Ę'(ĀB(›’@ ܏œ’,Ā$€™HH9' ų db„$ ܏€‚ü™`bQŒÄ’!˜ !čĄ!¬æØ¾¤· ¶œµ˜“”³²Œ±ˆ°ą°½'<ąœ'!ą™Ą’½'<æÆ8“Æ4³Æ0²Æ,±Æ(°Æ¼Æ0€™ˆš9' ų !ˆ !@@¼€‚™ ų $¤'ü`Ž$¢C¼ €‚ €… €‡ ƒ™dB$¢ÆÓ„$D#ē$$ ų +$¼$¢p„™ü`® ų $ė¼€P$pT$$ ¢Æ„™ ¢'ŒQ®! ¢Æ“Æ!($ ų !8$¼ˆC®€P®A„B®X™ ų DŒ’$¬‚¼ $©‚ø„™ ų ¼¢Æ €ƒ €… €‡c$ ƒ™£ÆÓ„$D#ē$$ ų 8$˜¼€“ų`bŽ&@ģ„™ ų ¼8€™ ų ! @¼!(` €„<€™`(†Œd(‡Œ ų ! @¼!(` €„<€™h(†Œl(‡Œ ų ! @¼ų`dŽ8€™!€@ ų !ˆ`¼! @€™!( !0@ ų !8`o@¼€PŽ’’%C€b0}@ €…€„$€™ĄE„$HH9' ų ’s0¼€‚ øEQŒ¼"– SÄ#ŽtBŽbĀ#–rB–b €‚1Žó’ O¼S¦„EŽ €†„™ü%B$¢Æ „$ÓĘ$$ ų  $!€@:@¼„FŽP„™F¬€EŽS$ ų ! `¼”4&$€™HH9' ų ! €Ō$Ž€¼!0†Œ!€!8€!(Cb’+C @ ¢Œ®°¬ ®Ą!Ì!Ą!(ą!0`!8@ė’@>Ō0®Ų"ŽP¬Ų0®$€™U9' ų ! €¼€„$€™U9' ų ĄE„$¼@®„Ž †ŽƒŽ…ŽĄB&ĄC®D¬ F¬E¬ ’€„ŠB¢$€™ ’ĄE„$U9' ų ŃB¢¼ €…Č€™$B®œ„$D& ų P$¼$€™¬E&˜X9' ų ”D&¼<æ8“4³0²,±(°$ą@½'Ä’€Ą’Ų0®<„Ūœ'!ą™Šź½'(¾Æ!š ,æÆ$·Æ ¶ÆµÆ“Æ³Æ²Æ ±Æ°Æ0¼ÆH‚™!˜€!(ˆÄ'@$ ų €rŽ0܏iÄ' €‚H‚™,B!($ ų hĀ£pb&„gŽ EŒHŒCŒpdŽ@ļ½'0“'$p‚®HÄÆPĆÆTÅÆ€¦8ĒÆLČÆŒbŽę,0܏ĄōĀÆ €‚§Æ €… €‡¬B$ ƒ™¢ÆÓ„$$x#ē$$ž$%¢ÆB’C’%C/@B’C’% C€‚0(@ā,@0€™L™ ų ! JƗ0܏’d0"% ƒ €ƒ €… €‡Ōc$ ƒ™¤Æ£Æ¢ÆÓ„$x#ē$$£$ ų Ł0܏ōƏ’„0HĘ'!(!8“9' ų £Æ0܏$q‚¦B’C’%Ck@!ØC’Āh@€‚$Ąbā,@S& €‚§Æ €… €‡(B$ ƒ™¢ÆÓ„$$x#ē$$¶$Ō’¢ÆqŠ$€™ų’ā$ōŏqšV’HÄ' U9' ų 8ĀÆ!€@@0܏L™ ų LďJƗ0܏’d0"% ƒ €… €ƒ €‡ ƒ™\c$¤ÆÓ„$x#ē$$Į$£Æ±’¢Æ&’B0’#2%D”‚™%CąÄ' ų %ØCäƏąĀ0܏D® H®<™4Ž ų 8Ž@0܏DŽHŽ4®8®$€„4Ž8ŽU‘$!Č ! @ĀÆ ų DĆÆ0܏h&H‚™€‚!ø ’€bS$Āś’b$8ĀÆ‘‘‘‘‘‘"%ˆE%f%€‡%% Ąü’b$8ĀÆ‘‘‘‘%ˆD%e%!€L™ ų LďJƗ0܏’d0"% ƒ €… €ƒ €‡ ƒ™œc$¤ÆÓ„$x#ē$$Ü$£ÆP’¢Æ8Ā*Q(@0€™ōĀ’d0!(HĘ'!8“9' ų ¢Æ’’B00܏¶@‚¦@!Ą# ‚(€‚$€™€bB$HH9' ų ! ‚0܏ˆÄ'!(!Čą ų @$‚–0܏€!SCŒ$”`ˆĀÆcŒ€`ØĀŒĆÆ QØĀÆŃÆ „–€!SBŒ’’<BŒ$C'%€!€SŽ<™ÜEŒ ų ŲDŒ@0܏ŽT‚™Ų„$ ų !(ŽŪh<ܤŒ­‹B4‚Ć0܏C#C N$0Cp#†# ‚ܤ¬Ždƒ™ÜGŒ@ďDŏ ų ŲFŒ0܏!U‚®‚–€!SBŒōBŒB0T@ €™ĀpŽ9' @¤ŁÆˆĆ$b8„™Ą™ ų ˆÄ'0܏”ĀÆ8„™ˆÅ' ų ! €0܏$€™`H9' ų ! € @0܏0€™! @$$°Į9' ų ‡&0܏‚–€!SCŒ.`„ŽbŒ+D)@わd¬BŒ%@€‚Ō`BŒ"@ €‚ €…ĢB$¢Æ‚– €‡¢Æ‚Ž ƒ™¢ÆÓ„$x#ē$! ų $0܏ €ƒ €… €‡ ƒ™čc$$£ÆÓ„$x#ē$ ų  $0܏$€™Œd9' ų „–0܏‚–$€™@!Ą# ‚(€‚U9'€bB$ ų ! ‚0܏8Ā!@Q#Q8ĀÆ8Əb,’ž@$^!襀‚Ō`BŒ @8Ə b, @ō’b$‚™¢Æ! !(@$ ų HĒ'0܏B’ĀD@$8Ā B,@L™ ų LďJƗ0܏’d0"% ƒ €… €ƒ €‡ ƒ™ c$¤ÆÓ„$x#ē$$!$£ÆUž¢ÆB’C’%C D’’Q0$€‚ˆÄÆŠAY$$ ‚ P’æ2 ų ‚20܏%€ŒŠÆ ų ! 0܏ŒĀÆˆĆ$b!8ŒĆ$b $b$ b$$ b$ b$!8!ˆˆĀÆŒĄÆ$‚–@0€™D’B’"% ‚ōĀ’„0!( HĘ'“9' ų ¢Æ0܏‚¦‚– @(€„$€™@Ą#b€b„$HH9' ų ! d0܏„–€€‚€€bB$!bcŒj`B’C’% C€‚0^@ŒĆ $b$b$b$$bˆĆ$QbB’C’%C’Q0’0€"6’C0’2$€™"*%b%(¤$ $XƧZŧbĀ£\ĄÆ`Ą£HG9' ų aĄ£0܏cĀ£€‚Ō`BŒ @わ‚™ Æ! XÅ'!0 ų HĒ'0܏わBŒ@HĀ'L™ ų LďJƗ0܏’d0"% ƒ €ƒ €… €‡ ƒ™pc$¤Æ£Æ¢Æ±Æ °ÆÓ„$ˆ#ē$! ų  $0܏HĀ'Ģ‚™¢Æōď$¢ÆXÅ' $ ų !80܏‚–u@@4ĄŒbŒB0 @0€™!(@ˆĘ'ä§9' ų 8Ē' @0܏ €‚ €… €‡ ƒ™”B$Ó„$x#ē$$Q$ƒ¢Æ€‚Ō`BŒ @8Ā‚™ō’B$¢Æ! !(@$ ų HĒ'0܏‚–€ƒ€€bc$!CDŒ ‚ŒB$ ‚¬‚–€!CDŒLĀ4ƒŒCJƗ2‚”b$ b$bB’C’%C’B0Ā‚¤B’Āā@€ƒÄƒ‚BŒ@€‚Ō`BŒ@ €‚ €…¬B$¢ÆB’ €‡¢ÆˆĀ ƒ™¢ÆŒĀÓ„$¢Æx#ē$! ų d$0܏B’ ‚® B’$‚®CŠCš.’d0’B0%E"%D%C‚®B’Ā@ˆĀųĄÆB8B,ųĀÆƒ–€‚€€bB$!bdŒ †Žž…d¦ŒĆ $ b$b$b$b$bˆĆ$TbŒĆŒÄ$‚ $ ‚$ ‚$ ‚$‚$‚$‚$‚㑏ˆĆ$Nb㑏"Ž@€ƒ €‚ €‡ĢB$¢Æ„ÆˆĀ €… ƒ™¦Æ ¤Æ¢ÆÓ„$x#ē$! ų Ž$0܏€ƒ„–€bp$€!PBŒ ƒŽžB#C¶@ˆĆ$bŒĆ$ab $_b"Ž @ €‚ €… €‡ ƒ™ B$¢ÆÓ„$x#ē$! ų —$0܏‚–‡Ž€!P%DŒ$ b $b$b$b$b¢$ˆĆ$b¢$ž‚ 8ď ‚,@ˆĆ €‚ €… €‡¬B$ ƒ™¢Æ¤Æ $Ó„$x#ē$$Æ$&¢Æ$b€eŽ’’¢$!Db @ˆbŽ+‚@!¤ƒ$@ 8ĆÆ` ƒ–€‚€€bB$!b8ĀdŒō’B$ĀÆ4ƒŒLĀƒCJƗ2‚”€bŒĆ $${bżüƒ!R‚B$’B0ü’C$„Ž_dわL ƒ™bŒ@$€™€†Ō`Œ@HH9' €™°Æ09'¹Æ! Óå&Ļ$!Č@ ų x#Ē&0܏$€™HH9' ų ’Ć0’B0%G%C6%Fl„™¢Æ¦'’„0 ų $¼ æą(½'ē$$ ų }$3(¼H‚™! @!(ō$ ų !˜@(¼d&Ų‚™!(€ ų O$$(¼b®H¢Æ@ €†„™$9Ę$! ą ų !(€!ˆ@@(¼B€@ €™! p9' ų !(!€@(@(¼ €‚ €… €‡ ƒ™09B$¢Æ±Æ“ƲÆ9„$°>ē$$ ų $(¼ €™! @p9' ų !(!€@@(¼ €‚ €… €‡ ƒ™t9B$¢Æ²Æ“Æ9„$°>ē$$ ų $×(¼!ˆ@€„ €™ÄŸ9' ų `Z„$(¼!0`8§'šh&ŒÌČ ŌĘ$ā¬ć¬ä¬ å¬ö’Čē$Œš&ā¬!0!8`ŒÌČ ŌĘ$ā¬ć¬ä¬ å¬ö’Čē$Œ<Ø'ā¬f&Œ§' %¬ƬĬ Ŭö’Ę$8¢€„ €™b®Ü¢`Z„$ܟ9' ų ¤b®(¼!( Ų‚™Td& ų O$(¼T`¢d™! ą ų !(€(¼!ˆ@Š‚™ €–!Ø ‚™@ ÆL¹ÆvD Æ0ŽtśE$!Č  ų ! @(¼ €…! !Č  ų Ą9„$0@(¼ €‚$ŽL¹HŽE$ ų 0¦'$C(¼0°ž’4*P@ €‚ €‚$Ž!Č  ų tśE$@(¼$@¢ÆMŚp¦$D¹ÆIąp¦ €‚ €‡Ģ9B$¢Æ"Ž ƒ™¢Æ"Ž“Æ¢Æ"ް>ē$$9Å&=$F ¢Æ €’! !Č  ų ü9E&@(¼ €…! !Č  ų :„$<@(¼ƒ™$Ž ų ,„'"@(¼BŒü9E&BŒ!Č PˆP˜4°Æ ų $Ž(¼’2 @’2’B0%C%C%C Üb®’B0%C%C%Cäb® €‚ €‡Ģ9B$¢Æ"Ž ƒ™¢Æ"Ž“Æ¢Æ"ް>ē$ ¢Æ$9Å&G$ ų ļ(¼ €…! !Č  ų „ „$@(¼¼„™ ų $Ž0¢Æ@(¼ąģb® €‚ €‡:B$¢Æ"Ž“Æ¢Æ"Ž ƒ™°>ē$$9Å&L$Ī¢Æ €…! !Č  ų ,ś„$@(¼ˆ„™$Ž ų še&Ä@(¼ €‚ €‡D:B$¢Æ"Ž ƒ™¢Æ°>ē$$9Å& ų O$¶(¼ €…! !Č  ų ’„$@(¼Ų‚™Øp&%Ž!  ų $(¼2Žü™!  ų !(@”@(¼ €‚²ÆŒ:B$°Æ¢Æ“Æ €‡"Ž ƒ™°>ē$$9Å&S$ ’ ¢Æ €…! !Č  ų Č:„$@(¼Ų‚™¼p&%Ž!  ų $(¼2Žü™!  ų !(@}@(¼ €‚²ÆŠ:B$°Æ¢Æ“Æ €‡"Ž ƒ™°>ē$$9Å&W$|’ ¢Æ €…! !Č  ų ¬ł„$@(¼Ų‚™Šp&%Ž!  ų  $(¼2Žü™!  ų !(@Y@(¼ €‚²Æ ;B$°Æ¢Æ“Æ €‡"Ž ƒ™°>ē$$9Å&[$X’ ¢Æ €’! !Č  ų H;E&@(¼ €™`ž9' ų $Ž$(¼”ƒ™H;E&!  ų $@(¼™!  ų +$ @(¼ €™$Ž`ž9' ų čpŽ(¼%P™!  ų -$ @(¼ €™$Ž`ž9' ų čpŽ'(¼$Pčb® €…! !Č  ų $9„$@(¼ €‚°ÆP;B$¢Æ“Æ"Ž €‡ ƒ™¢Æ°>ē$$9Å&c$ ų (¼1ŽŠž  €‚@¹ D¢Ł$Śb¦D¢Y@Ł$Wąb¦H¹ 쁂€ €™ÄŸ9' ų `Z&(¼`Z&4‚ƒ €™bŒÜŸ9'¤b® ų s¬(¼ģ‚BŒB(@Ž' €„ü„™ˆ;„$ ų !(€(¼Ųƒ™!(€ ų ! ą(¼! @ż€ €‚ ‚™ ų ! ą (¼ €‚ €… €‡“;B$ ƒ™¢Æ9„$€>ē$$ ų $(¼!ˆ€„ €™ÄŸ9' ų `Z„$(¼4‚‚¼€™DŒ! !˜@‚Œ@¤Œ !ˆ€ ¤0®p®!Č@ ų (¼! š’€€„©’`® €™ÜŸ9' ų `Z„$(¼!( €„P™ ų ü;„$(¼tæp¾l·h¶dµ`“\³X²T±P°!ąx½'<“/œ'!ą™ą’½'æÆ¼ÆD€‚€„Č‚™b@¬[„$ ų $¼æ!ą ½'B!ˆ€! )¤'!((¢£! Ą ų O$ ¼x³'H‚™!($ ų ! ` ¼(°'€„ €™ÄŸ9' ų `Z„$ ¼!(@ €„ü€™ü;„$!0 ų P$ ¼!  €…‚™ <„$ ų !0 $!C ¼ €…ü™!  ų <„$@ ¼+’’$܄™! `!( !8€ ų !0@!€@"@ ¼ €‚ €… €‡ ƒ™$ē$! ų ż$ ¼Äƒ‚BŒ@ €‚#Ž €… €‡ ƒ™Tē$! ų $ ¼!€€„ €™ÜŸ9' ų `Z„$! ¼”提“Œ³ˆ²„±€°ą˜½'<,*œ'!ą™Č’½'4æÆ0¶Æ,µÆ(“Æ$³Æ ²Æ±Æ°Æ¼Æ™!  !Ø  ų !°ą¼! @€„ €™ÄŸ9' ų `Z„$¼!ˆ4‚‚”ƒ™PŒ!˜ !Č` ų  @¼1&*Ń@l‚™ ų ! @¼!€@¤Ž&!  !(@ķ’!0€€„ €™ÜŸ9' ų `Z„$!¼4æ0¶,µ(“$³ ²±°ą8½'<)œ'!ą™Ą’½'8æÆ4·Æ0¶Æ,µÆ(“Æ$³Æ ²Æ±Æ°Æ¼Æ!€€! ;€!øĄ ™7!€€‚!  EQ$ˆ‚™€‚ €–!˜ DEU$€ "Ž$ā@!Ȁ ų ! #Bü’%޼’’F$!Č` ų ! ¼!Ȁ ų ! #B¼’’F$! !Č` ų |<Å&¼1&å’5‚ @™ €…Ų‚™Čš„$’’F& ų ! ¼ ų ! !¼’’@ !8æ4·0¶,µ(“$³ ²±°ą@½'<ø'œ'!ą™P’½'¬æÆØ¾Æ¤·Æ ¶ÆœµÆ˜“Ɣ³Æ²ÆŒ±Æˆ°Æ¼Æż’¢$B,!Ø !€@ø¦ÆĘ$€„ €™ÄŸ9' ų `Z„$¼!˜Č€™4‚‚!° t„™PŒ!ˆ X„™ €‚!š $‚™šļT$˜!ø ¢ø¢Š‚™ DŒ ų &@¼` €™ €…! @!Č  ų x„$¼ €™ž9' ų ÜŽ¼!(@$!ČĄ ų ¤'¼ €™ž9' ų 䎼!(@$!ČĄ ų (¤'¼! @ €‚&!Č  ų €CŒą>BŒ# X€™<$!ˆ “Æ(¤Æ,±Æ ų !€€R$¼ @! \€™!(  ų !0@# ’¼(¢Æ,£Æ ¤ÆP€™³Æ ų ¤'¼Dæ@“<³8²4±0°ąH½'!@€Ą!H  $#F`!P#XD dÅPČ%Xƒ!@@!H`!ą! $€™!xą ų =$€™!xą ų ;$€™!xą ų :$€™!xą ų 9$€™!xą ų 8$€™!xą ų 7$€™!xą ų 6$€™!xą ų 5$€™!xą ų 4$€™!xą ų 3$€™!xą ų 2$€™!xą ų 0$€™!xą ų /$€™!xą ų .$€™!xą ų ,$€™!xą ų +$€™!xą ų *$€™!xą ų )$€™!xą ų ($€™!xą ų '$€™!xą ų &$€™!xą ų %$€™!xą ų $$€™!xą ų "$€™!xą ų !$€™!xą ų  $<šœ'!ą™ą’½'¼ÆæÆ¼Æ<Ģœ'!ąŸ$€™`@9' ų ¼æą ½'*UNREACHABLELAGGED (%d ms)OK (%d ms)UNKNOWNUnmonitoredchan_iax2.cI should never be called! New max nontrunk callno is %d New max trunk callno is %d Can't compress subclass %d calc_timestamp: call %d/%d: Timestamp slaved to delivery time predicted timestamp skew (%u) > max (%u), using real ts instead. Encoding full frame %d/%d with length %d Encoding full frame %d/%d with length %d + %d padding (15=%02x) Encoding mini frame with length %d Sending %d on %d/%d to %s:%d Received error: %s Created trunk peer for '%s:%d' Uh, this isn't a good sign... No private structure for packet? Out of memory Supposed to send packet encrypted, but no key? Expanded trunk '%s:%d' to %d bytes Maximum trunk data space exceeded to %s:%d Transferring '%s' to '%s' Answering IAX2 call Write error: %s Indicating condition %d passthrough -- Can't masquerade, we're different... -- Operating with different codecs %d[%s] %d[%s] , can't native bridge... Unable to start the transfer @:[]/Format for registration is user[:secret]@host[:port] at line %d %s is not a valid port number at line %d aes128rsamd5plaintextSocket: %s Can't bind: %s Non-local or unbound address specified (%s) in sourceaddress for '%s', reverting to default Unable to bind to sourceaddress '%s' for '%s', reverting to default Using sourceaddress %s for '%s' secretmailboxmohinterpretmohsuggestdbsecrettrunkUnable to support trunking on peer '%s' without zaptel timing authencryptionnotransferThe option 'notransfer' is deprecated in favor of 'transfer' which has options 'yes', 'no', and 'mediaonly' transfermediaonlyjitterbufferforcejitterbufferhostdynamic255.255.255.255defaultipsourceaddresspermitdenymaskregextenpeercontextusernameallowdisallowcalleridfullnamecid_numbersendaniinkeysoutkeyqualifynoyesQualification of peer '%s' should be 'yes', 'no', or a number of milliseconds at line %d of iax.conf qualifysmoothingqualifyfreqokQualification testing frequency of peer '%s' when OK should a number of milliseconds at line %d of iax.conf qualifyfreqnotokQualification testing frequency of peer '%s' when NOT OK should be a number of milliseconds at line %d of iax.conf Set peer->pokefreqnotok to %d timezoneadsiiax2_process_threadOut of idle IAX2 threads for scheduling! Asked to authenticate to %s with an RSA key, but they don't allow RSA authentication No challenge provided for RSA authentication to %s Unable to find private key '%s' Unable to sign challenge with key %2.2xNo way to send secret to peer '%s' (their methods: %d) Decoding full frame with length %d (padding = %d) (15=%02x) Decoding mini with length %d ;Parked on extension '%d' No IAX2 pvt found for callno '%d' ! IAX2/%s-%dUnable to start PBX on %s NoopIAX2&Auto-congesting call due to slow response iaxpeersipaddrregsecondsExpiring registration for peer '%s' PeerStatusPeer: IAX2/%s PeerStatus: Unregistered Cause: Expired IAX/RegistryIAX2/%sschedule_delivery: pushed forward timestamp schedule_delivery: pushed back timestamp calc_rxstamp: call=%d: rxcore set to %d.%6.6d - %dms calc_rxstamp: call=%d: works out as %d.%6.6d IAX2 JB interpolationCan't make trunk once a call has started! Call %d is already a trunk Unable to trunk call: Insufficient space Made call %d into trunk call %d IAX2 Trunk Debugging Disabled IAX2 Debugging Disabled IAX2 Trunk Debug Requested IAX2 Debugging Enabled %-20.20s %-6.6s %-10.10s %-20.20s %8.8s %s HostdnsmgrUsernamePerceivedRefreshState%s:%dNNo AuthenticationUnknownUnregisteredRequest SentAuth. SentRegisteredRejectedTimeout%-20.20s %-6.6s %-10.10s %-20.20s %8d %s %-15.15s %-15.15s %-15.15s DeviceVersionSize%-15.15s %-15d %-15d IAX2 Thread Information Idle Threads: Thread %d: state=%d, update=%d, actions=%d, func ='%s' Active Threads: Thread %c%d: state=%d, update=%d, actions=%d, func ='%s' Dynamic Threads: %d of %d threads accounted for with %d dynamic threads IAX2 Jitterbuffer Debugging Enabled IAX2 Jitterbuffer Debugging Disabled IAX Statistics --------------------- Outstanding frames: %d (%d ingress, %d egress) Packets in transmit queue: %d dead, %d final, %d total %-25.25s %4d %4d %4d %5d %3d %5d %4d %6d %4d %4d %5d %3d %5d %4d %6d %s %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d (None) -------- LOCAL --------------------- -------- REMOTE -------------------- Channel RTT Jit Del Lost %% Drop OOO Kpkts Jit Del Lost %% Drop OOO Kpkts %d active IAX channel%s registeredlike%-15.15s %-15.15s %s %-15.15s %-8s %s %-10s%sName/UsernameMaskPort(Unspecified)(D)(S)(T)(E)%-15.15s %-15.15s %s %-15.15s %-5d%s %s %-10s%s%d iax2 peers [%d online, %d offline, %d unmonitored]%s%s/%sBeginning trunk processing. Trunk queue ceiling is %d bytes per host Unable to read from timing fd - Trunk peer (%s:%d) has %d call chunk%s in transit, %d bytes backloged and has hit a high water mark of %d bytes Dropping unused iax2 trunk peer '%s:%d' Ending trunk processing with %d peers and %d call chunks processed chan_iax2: Sent %d queued outbound frames all at once chan_iax2: ast_io_wait ran %d I/Os all at once chan_iax2: ast_sched_runq ran %d scheduled tasks all at once Registration RefusedNo authority foundAvoiding IAX destroy deadlock Still have a callno... Unable to allocate call for poking peer '%s' -- Seeding '%s' at %s:%d for %d typefriendpeerrealtime_peer: Bah, '%s' is expired (%d/%d/%d)! realtime_peer: Registration for '%s' still active (%d/%d/%d)! No more space Creating new call structure %d Out of resources Checking device state for device %s iax2_devicestate: Found peer. What's device state of %s? addr=%d, defaddr=%d maxms=%d, lastms=%d CURRENTCHANNELipstatusexpirecallerid_namecallerid_numcodecscodec[No such peer '%s' Peer '%s' is now UNREACHABLE! Time: %d Peer: IAX2/%s PeerStatus: Unreachable Time: %d Sending registration request for '%s' Unable to send registration request for '%s' without IP address Allocate call number Unable to create call for registration Registration created on call %d We're hanging up %s now... Really destroying %s now... -- Hungup '%s' Max retries exceeded to host %s on %s (type = %d, subclass = %d, ts=%d, seqno=%d) /var/tmp/%s-%ldFailed to stat '%s': %s Cannot open '%s': %s Cannot open '%s' for writing: %s Only read %d of %d bytes of data :(: %s Only write %d of %d bytes of data :(: %s Unable to read firmware header in '%s' '%s' is not a valid firmware file Invalid data length in firmware '%s' No or invalid device type specified for '%s' mmap failed: %s Firmware file '%s' fails checksum %s/firmware/iax == Loaded firmware '%s' Error opening firmware directory '%s': %s IAXpeersIAXnetstatsload * Name : %s Secret : %s Context : %s Mailbox : %s YesNo Dynamic : %s Callerid : %s Expire : %d ACL : %s Addr->IP : %s Port %d Defaddr->IP : %s Port %d Username : %s Codecs : Codec Order : (none Status : OnOff Qualify : every %dms when OK, every %dms when UNREACHABLE (sample smoothing %s) Peer %s not found. %-20.20s %-12.12s %-9.9s %-8.8s %s Peer/ContextExtenExp.Wait.FlagsEXISTS|NONEXISTENT|CANEXIST|PENDING|TIMEOUT|TRANSMITTED|MATCHMORE|UNKNOWN|(none)%-20.20s %-12.12s %-9d %-8d %s %-20.20s %-12.12s %-9.9s %-8d %s (expired)No such host: %s Unable to retrieve database password for family/key '%s'! peer: %s, username: %s, password: %s, context: %s Unable to create call TBDDP still has peer field or pending or callno (flags = %d, peer = %p callno = %d) Unable to generate call for '%s' No more waiter positions available Unable to create pipe for comm Timeout waiting for %s exten %s asdfDIALSTATUSIAX2/%s/%s@%sIAX2/%s/%s -- Executing Dial('%s') Can't execute nonexistent extension '%s[@%s]' in data '%s' DialNo dial application registered Unable to make DP cache No peer given Unable to create translator path for %s to %s on %s Provisioning '%s' from template '%s' No provisioning found for template '%s' forcedUnable to find peer/address '%s' No template (including wildcard) matching '%s' , forcedProvisioning '%s' with template '%s'%s si-%sService identifier '%s', we think '%08x', they think '%08x' Channel is already in use (%s)? No address associated with '%s' %-15.15s %-20.20s %-15.15s %-15.15s %-5.5s %-5.10s SecretAuthenDef.ContextA/CCodec Pref-no secret-REQ OnlyDisabledCaller%-15.15s %-20.20s %-15.15d %-15.15s %-5.5s %-5.10s Key: %-15.15s ActionID ActionID: %s %-20.20s %-15.15s %-10.10s %-11.11s %-11.11s %-7.7s %-6.6s %-6.6s %s ChannelPeerID (Lo/Rem)Seq (Tx/Rx)LagJitterJitBufFormat%-20.20s %-15.15s %-10.10s %5.5d/%5.5d %5.5d/%5.5d %-5.5dms %-4.4dms %-4.4dms %-6.6s requested inkey '%s' for RSA authentication does not exist defaultCan't provision a non-IAX device! Can't provision something with no IP? -- Provisioned IAXY at '%s' with '%s'= %d setvarUnable to support trunking on user '%s' without zaptel timing codecprioritycallerdisabledreqonlyaccountcodelanguageamaflagsInvalid AMA Flags: %s at line %d maxauthreq%s;%sasreceivedUnable to load config %s generaltosInvalid tos value, see doc/ip-tos.txt for more information. bindportIgnoring bindport on reload pingtimeiaxthreadcountIgnoring any changes to iaxthreadcount during reload iaxthreadcount must be at least 1. limiting iaxthreadcount to 256 iaxmaxthreadcountiaxmaxthreadcount must be at least 0. Limiting iaxmaxthreadcount to 256 nochecksumsmaxjitterbufferresyncthresholdmaxjitterinterpslagrqtimemaxregexpireminregexpirebindaddrIgnoring bindaddr on reload Unable apply binding to '%s' at line %d == Binding IAX2 to '%s' == Binding IAX2 to '%s:%d' authdebugdelayrejectrtcachefriendsrtignoreregexpirertupdatetrunktimestampsrtautocleartrunkfreqautokillNice try, but autokill has to be >0 or 'yes' or 'no' at line %d bandwidthlowmediumhighbandwidth must be either low, medium, or high registeriaxcompatregcontextInvalid tos value at line %d, see doc/ip-tos.txt for more information.' 0.0.0.0Unable to create network socket: %s == Binding IAX2 to default address 0.0.0.0:%d Could not allocate outsock list. Minimum registration interval of %d is more than maximum of %d, resetting minimum to %d users.confhasiaxregisteriaxuserUnknown type '%s' for '%s' in %s Section '%s' lacks type %s:%s@%sCould not allocate netsock list. List IAX PeersShow IAX Netstatsiax.confUnable to register channel class %s Unable to register IAX switch Failed to create new thread! sched_threadnetwork_thread == %d helper threaads started == IAX Ready and Listening allOK cache is flushed. OK peer %s was removed from the cache. SORRY peer %s is not eligible for this operation. SORRY peer %s was not found in the cache. Peer '%s' has too new a protocol version (%d) for me iaxusersEmpty registration from %s No registration for peer '%s' (from %s) Peer '%s' is not dynamic (from %s) Host %s denied access to register peer '%s' requested inkey '%s' does not exist Host %s failed RSA authentication with inkeys '%s' Host '%s' trying to do RSA authentication, but we have no inkeys Host %s failed MD5 authentication for '%s' (%s != %s) Host %s did not provide proper plaintext password for '%s' Inappropriate authentication received %s:%d:%dAUTHENTICATEDUNAUTHENTICATED -- Registered IAX2 '%s' (%s) at %s:%d Peer: IAX2/%s PeerStatus: Registered -- Unregistered IAX2 '%s' (%s) Peer: IAX2/%s PeerStatus: Unregistered Restricting registration for peer '%s' to %d seconds (requested %d) Out of idle IAX2 threads for I/O, pausing! Error: %s socket_processmidget packet received (%d of %zd min) Rejecting packet from '%s.%d' that is flagged as a video frame but is too short midget meta trunk packet received (%d of %zd min) Unable to accept trunked packet from '%s:%d': No matching peer Unknown meta trunk cmd from '%s:%d': dropping For call=%d, set last=%d Received trunked frame before first full voice frame Rejecting packet from '%s.%d' that is flagged as a full frame but is too short Raw Hangup %s:%d, src=%d, dst=%d Packet Decrypt Failed! Received packet %d, (%d, %d) Packet arrived out of order (expecting %d, got %d) (frametype = %d, subclass = %d) Acking anyway Cancelling transmission of packet %d Really destroying %d, having been acked on final message Received iseqno %d not within window %d->%d Undecodable frame received from '%s' Ooh, voice format changed to %d Neat, somebody took away the channel at a magical time but i found it! Ooh, video format changed to %d IAX subclass %d received HoldChannel: %s Uniqueid: %s UnholdRejected connect attempt from %s, who was trying to reach '%s@%s' No such context/extensionRejected connect attempt from %s, request '%s@%s' does not exist mineUnable to negotiate codecRejected connect attempt from %s, requested 0x%x incompatible with our capability 0x%x. Rejected connect attempt from %s, requested/capability 0x%x/0x%x incompatible with our capability 0x%x. No best format in 0x%x??? -- Accepting UNAUTHENTICATED call from %s: %srequested format = %s, %srequested prefs = %s, %sactual format = %s, %shost prefs = %s, %spriority = %s > -- Accepted unauthenticated TBD call from %s Unauthenticated call limit reacheddp_lookup_threadUnable to start lookup thread! Immediately destroying %d, having received hangup Call rejected by %s: %s Immediately destroying %d, having received reject BLINDTRANSFERParking/%sIAXPeer/%sMasquerade failed :( iax_park_threadFailed to park call on '%s' Parked call on '%s' Async goto of '%s' to '%s@%s' failed Async goto of '%s' to '%s@%s' started Async goto not applicable on call %d -- Call accepted by %s (format %s) Rejected call to %s, format 0x%x incompatible with our capability 0x%x. -- Format for call is %s Peer '%s' is now REACHABLE! Time: %d Peer: IAX2/%s PeerStatus: Reachable Time: %d Peer '%s' is now TOO LAGGED (%d ms)! Peer: IAX2/%s PeerStatus: Lagged Time: %d Peer %s: got pong, lastms %d, historicms %d, maxms %d LAGRQPeer %s lag measured as %dms Call on %s is already up, can't start on it I don't know how to authenticate %s to %s Host %s failed to authenticate as %s We don't do requested format %s, falling back to peer capability %d -- Accepting AUTHENTICATED call from %s: %srequested format = %s, %srequested prefs = %s, %sactual format = %s, %shost prefs = %s, %spriority = %s -- Accepted AUTHENTICATED TBD call from %s Rejected dial attempt from %s, request '%s@%s' does not exist -- Accepting DIAL from %s, formats = 0x%x Immediately destroying %d, having received INVAL Destroying call %d Received VNAK: resending outstanding frames Registry error Registry acknowledge on unknown registry '%s' Received unsolicited registry ack from '%s' with %d new and %d old messages waiting with %d new messages waiting with 1 new message waiting with no messages waiting -- Registered IAX2 to '%s', who sees us as %s%s ChannelDriver: IAX2 Domain: %s Status: Registered Registration failure Registration of '%s' rejected: '%s' from: '%s' ChannelDriver: IAX2 Username: %s Status: Rejected Cause: %s Received unsolicited registry authenticate request from '%s' No secret associated with peer '%s' Can't reregister without a reg -- Channel '%s' unable to transfer -- Channel '%s' ready to transfer -- Attempting media bridge of %s and %s -- Releasing %s and %s Invalid transfer request Peer did not understand our iax command '%d' Unknown IAX command %d on %d/%d Received mini frame before first full video frame Received mini frame before first full voice frame Datalen < 0? Received out of order packet... (type=%d, subclass %d, ts = %d, last = %d) IAXPEERGets IAX peer informationIf peername specified, valid items are: - ip (default) The IP address. - status The peer's status (if qualify=yes) - mailbox The configured mailbox. - context The configured context. - expire The epoch time of the next expire. - dynamic Is it dynamic? (yes/no). - callerid_name The configured Caller ID name. - callerid_num The configured Caller ID number. - codecs The configured codecs. - codec[x] Preferred codec index number 'x' (beginning with zero). If CURRENTCHANNEL specified, returns IP address of current channel IAXPEER([|item])chan_iax2Inter Asterisk eXchange (Ver 2)This paragraph is copyright (c) 2006 by Digium, Inc. In order for your module to load, it must return this key via a function called "key". Any code which includes this paragraph must be licensed under the GNU General Public License version 2 or later (at your option). In addition to Digium's general reservations of rights, Digium expressly reserves the right to allow other parties to license this paragraph under different terms. Any use of Digium, Inc. trademarks or logos (including "Asterisk" or "Digium") without express written permission of Digium, Inc. is prohibited. IAX2Provisioniax2showcacheDisplay IAX cached dialplanList active IAX channelsfirmwareList available IAX firmwaresList active IAX channel netstatspeersList defined IAX peersregistryDisplay IAX registration statusDisplay IAX statisticsthreadsDisplay IAX helper thread infousersList defined IAX usersprunerealtimePrune a cached realtime lookupreloadReload IAX configurationShow details on specific IAX peersetEnable IAX debuggingEnable IAX trunk debuggingjbEnable IAX jitterbuffer debuggingoffDisable IAX debuggingDisable IAX trunk debuggingDisable IAX jitterbuffer debuggingtestlosspctSet IAX2 incoming frame loss percentageprovisionProvision an IAX deviceIAX Remote Dialplan SwitchProvision a calling IAXy with a given template IAX2Provision([template]): Provisions the calling IAXy (assuming the calling entity is in fact an IAXy) with the given template or default if one is not specified. Returns -1 on error or 0 on success. Tłų’\łų’dłų’lłų’tłų’|łų’<łų’€?ś’Ģ_ś’aś’ˆ“ś’¬Rś’HSś’ÜZś’¼fś’Ägś’Xxś’xeś’xeś’ģyś’€ś’ˆ|ś’h€ś’ģyś’yś’šPś’lŽś’štś’`Šś’‹ś’L>ś’¤…ś’ą‹ś’”„ś’L<ś’h=ś’”_ś’ ’ś’ ’ś’ś’ÄTś’ ’ś’\ś’ ’ś’øś’iax2_transfer__send_commandiax2_sendcalc_timestampcompress_subclassiax2_trunk_queuefind_tpeerencrypt_framesend_packetiax2_setoptioniax2_fixupiax2_indicateiax2_bridgeiax2_writeiax2_readiax2_answeriax2_hangupiax2_matchmorefind_cachecache_get_callno_lockedcreate_addrfind_callnorealtime_peerbuild_peerpeer_set_srcaddrcheck_srcaddrsocket_readfind_idle_threadfind_idle_threadsocket_processraw_hangupdecode_framemake_trunkupdate_max_trunkcheck_accessbuild_userbuild_contextspawn_dp_lookupspawn_dp_lookupiax_parkiax_parkiax_park_threadauthenticateauthenticate_verifyast_iax2_newregister_verifyauth_reject__schedule_actionupdate_registryregister_peer_exteniax2_poke_peeriax2_poke_noanswer__iax2_poke_noanswercheck_provisioningiax2_provisionauto_hangupregistry_authrequestiax2_ack_registryiax2_do_register_siax2_do_registerregistry_rerequesttry_transfercomplete_transferunwrap_timestampcalc_rxstampget_from_jbiax2_poke_peer_sdefer_full_frameexpire_registry__expire_registrynew_iaxupdate_max_nontrunksend_lagrqsend_pingiax2_execiax2_canmatchiax2_existsjb_warning_outputjb_error_outputset_configiax2_registercomplete_iax2_show_peerreload_firmwaretry_firmwareload_modulestart_network_threadstart_network_threadnetwork_threadattempt_transmit__attempt_transmittiming_readtransmit_trunksched_threadiax2_prov_appiax_error_outputiax2_destroyiax2_callauto_congest__auto_congestiax2_devicestateiax2_requestInter Asterisk eXchange Driver (Ver 2)Y@>Unknown IEAttempt to double free frame detected WARNING: %siax2-parser.cLosing frame data because destination buffer size '%d' bytes not big enough for '%d' bytes in the frame Out of space for ie '%s' (%d), need %d have %d RDRxTxTE%03d No(%d?)%c%s-Frame Retry[%s] -- OSeqno: %3.3d ISeqno: %3.3d Type: %s Subclass: %s Timestamp: %05lums SCall: %5.5d DCall: %5.5d [%s:%d] Total IE length of %d bytes exceeds remaining frame length of %d bytes %d bytesPresent Unknown IE %03d : Present IPV4 %s:%dInvalid AddressTotal Prov IE length of %d bytes exceeds remaining prov frame length of %d bytes %-15.15s : %s Unknown Prov IE %03d : Present ,8khz,11.025khz,16khz,22.05khz,44.1khz,48khzNone Specified! Invalid SHORTInvalid IPADDRInvalid BYTE%Y-%m-%d %TInvalid DATETIME format!%luInvalid INT%lu (%s)Information element length exceeds message size Expecting capability to be %d bytes long but was %d Expecting format to be %d bytes long but was %d Expecting version to be %d bytes long but was %d Expecting adsicpe to be %d bytes long but was %d Expecting samplingrate to be %d bytes long but was %d Expecting authmethods to be %d bytes long but was %d Expecting encryption to be %d bytes long but was %d Expecting refresh to be %d bytes long but was %d Expecting dpstatus to be %d bytes long but was %d Expecting callno to be %d bytes long but was %d Expecting causecode to be single byte but was %d Expected single byte Unknown command, but was %d long Expecting msgcount to be %d bytes long but was %d Expecting transferid to be %d bytes long but was %d Expecting date/time to be %d bytes long but was %d Expecting firmwarever to be %d bytes long but was %d Expected block desc to be %d bytes long but was %d Expected provisioning version to be %d bytes long but was %d Expected single byte callingpres, but was %d long Expected single byte callington, but was %d long Expecting callingtns to be %d bytes long but was %d Expected jitter rr to be %d bytes long but was %d Expected loss rr to be %d bytes long but was %d Expected packets rr to be %d bytes long but was %d Ignoring unknown information element '%s' (%d) of length %d Invalid information element contents, strange boundary (0?)HANGUP RING RINGINGANSWER BUSY TKOFFHKOFFHOOKCONGSTNFLASH WINK OPTION RDKEY RDUNKEYPROGRESPROCDNGHOLD UNHOLD VIDUPDTNEW PING PONG ACK REJECT ACCEPT AUTHREQAUTHREPINVAL LAGRQ LAGRP REGREQ REGAUTHREGACK REGREJ REGREL VNAK DPREQ DPREP DIAL TXREQ TXCNT TXACC TXREADYTXREL TXREJ QUELCH UNQULCHPOKE PAGE MWI UNSPRTDTRANSFRPROVISNFWDWNLDFWDATA TXMEDIADTMF_E VOICE VIDEO CONTROLNULL IAX TEXT IMAGE HTML CNG MODEM DTMF_B CALLED NUMBERCALLING NUMBERANICALLING NAMECALLED CONTEXTUSERNAMEPASSWORDCAPABILITYFORMATLANGUAGEVERSIONADSICPEDNIDAUTHMETHODSCHALLENGEMD5 RESULTRSA RESULTAPPARENT ADDRESSREFRESHDIALPLAN STATUSCALL NUMBERCAUSEUNKNOWN IAX CMDMESSAGE COUNTAUTO ANSWER REQTRANSFER IDREFERRING DNISPROVISIONINGAES PROVISIONGDATE TIMEDEVICE TYPESERVICE IDENTFIRMWARE VERFW BLOCK DESCFW BLOCK DATAPROVISIONG VERCALLING PRESNTNCALLING TYPEOFNUMCALLING TRANSITNETSAMPLINGRATECAUSE CODEENCRYPTIONENCRYPTION KEYCODEC_PREFSRR_JITTERRR_LOSSRR_PKTSRR_DELAYRR_DROPPEDRR_OUTOFORDERUSEDHCPSUBNETGATEWAYBINDPORTTYPEOFSERVICEFLAGSAESKEYSERVERIPSERVERPORTNEWAESKEYPROV VERSIONALTSERVERIPx¹ś’€¹ś’ˆ¹ś’¹ś’˜¹ś’ ¹ś’عś’ø¹ś’ŗś’tŗś’|ŗś’°ŗś’»ś’(»ś’»ś’˜»ś’ »ś’Ø»ś’°»ś’仜’¼ś’T¼ś’ˆ¼ś’“¼ś’š¼ś’ü¼ś’½ś’ »ś’@Įś’@Įś’`½ś’ō½ś’ü½ś’ø½ś’¾ś’\¾ś’t¾ś’Ō¾ś’æś’<æś’äŗś’\¼ś’\»ś’h¾ś’°¹ś’xæś’Šæś’(Ąś’hĄś’ØĄś’襜’iax_frame_newiax_frame_wrapiaxprov.confiax2-provision.cOut of memory! templateUnable to find base template '%s' for creating '%s'. Trying '%s' Unable to locate default base template '%s' for creating '%s', omitting. serverportIgnoring invalid %s '%s' for '%s' at line %d serveraltserverIgnoring invalid codec '%s' for '%s' at line %d Invalid tos value at line %d, see doc/ip-tos.txt for more information. Truncating username from '%s' to '%s' for '%s' at line %d passTruncating password from '%s' to '%s' for '%s' at line %d Truncating language from '%s' to '%s' for '%s' at line %d flagsUnknown keyword '%s' in definition of '%s' at line %d -- Loaded provisioning template '%s' No IAX provisioning configuration found, IAX provisioning disabled. iax/provisioning/cachev0x%08xuv%xUnable to create provisioning packet for '%s' Retrieved cached version '%s' = '%08x' ,== %s == Base Templ: %s Username: %s Secret: %s Language: %s Bind Port: %d Server: %s Server Port: %d Alternate: %s Flags: %s Format: %s TOS: 0x%x No provisioning templates found No provisioning template matching '%s' found Display iax provisioningsecureheartbeatdisableciddisablecwdisablecidcwdisable3wayiax_provision_reloadiax_process_templateiax_template_parseiax_provision_versionąĮ’’’’Œ3’’’’p3pŽ,(’’`clČiliLmT,¬g E$jųhœhHhhpDmĄWl@f$j\O <<ø1Ą1Č1Š1Ų1ą1č1š1ų12222 2(20282@2H2ø1P2X2`2h2Ą1p2x2€2ˆ22˜2 2Ø2°2ø2Ą2Č2Š2Ų2ą2č2š2ų23333 3(30383@3H3P3X3`3h3p3ø1x3€3ˆ33˜3 3Ø3°3ø3Ą3Č3Š3Ų3”Šč3”Šų3”Šü3”Š 4”Š4”Š(4”Š44,’ @4,’ H4”Š T4œ“ \4œ“ d4”Šl4œ“x4”Š„4”А4”Šœ4Ą‰°4œ“ø4œ“Č4œ“Ō4”ŠÜ4‘ģ4œ“ü4 5,’5”Š(5¼‹85H5T‘ T5”Š!`5”Š"p5œ“#€5,’$5% 5,’&°5‘'Ą5‘(Ō5œ“)č5ĄŽ*ų5‘+6œ“,6- 6ųŠ.,6,’/86,’0@6,’1H6œ“2T6,’3`6,’p6 +|x6|€6|ˆ6œ“4”Š(4”Š H4”Š ”6‘ ¤6”’ @4,’¬6“6|Ą6œ“Ģ6Ų6,’č6|¤żą=č=˜üō=> >@>€€b$@’’’’’’’’’’’’@ x’’ddefaultčč  Usage: iax2 show cache Display currently cached IAX Dialplan results. Usage: iax2 show channels Lists all currently active IAX channels. Usage: iax2 show firmware Lists all known IAX firmware images. Usage: iax2 show netstats Lists network status for all currently active IAX channels. Usage: iax2 show peers [registered] [like ] Lists all known IAX2 peers. Optional 'registered' argument lists only peers with known addresses. Optional regular expression pattern is used to filter the peer list. Usage: iax2 show registry Lists all registration requests and status. Usage: iax2 show stats Display statistics on IAX channel driver. Usage: iax2 show threads Lists status of IAX helper threads Usage: iax2 show users [like ] Lists all known IAX2 users. Optional regular expression pattern is used to filter the user list. Usage: iax2 prune realtime [|all] Prunes object(s) from the cache Usage: iax2 reload Reloads IAX configuration from iax.conf Usage: iax2 show peer Display details on specific IAX peer Usage: iax2 set debug Enables dumping of IAX packets for debugging purposes Usage: iax2 set debug trunk Requests current status of IAX trunking Usage: iax2 set debug jb Enables jitterbuffer debugging information Usage: iax2 set debug off Disables dumping of IAX packets for debugging purposes Usage: iax2 set debug trunk off Requests current status of IAX trunking Usage: iax2 set debug jb off Disables jitterbuffer debugging information Usage: iax2 test losspct For testing, throws away percent of incoming packets Usage: iax2 provision